Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "young"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

3. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

4. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

5. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

6. He set up a charitable trust to support young entrepreneurs.

7. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

8. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

9. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

10. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

11. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

12. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

Random Sentences

1. Nous allons nous marier à l'église.

2. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

3. He has fixed the computer.

4. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

5. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

6. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

7. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

8. Napakagaling nyang mag drowing.

9. Ipinagbibili ko na ang aking bahay.

10. Nakakalungkot isipin na hindi na ako makakapakinig ng bagong awitin mula sa Bukas Palad dahil sa pagkawala ni Fr. Manoling.

11. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

12. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

13. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

14. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

15. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

16. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

17. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

18. Dalawa ang kalan sa bahay namin.

19. Pinagbubuksan ko ang mga bintana.

20. Kleine Geschenke erhalten die Freundschaft.

21. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

22. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

23. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

24. El lienzo es la superficie más común utilizada para la pintura.

25. Ang kundiman ay nagbibigay-buhay sa mga alaala ng pag-ibig na nagdaan.

26. Las hojas de los árboles cambian de color en otoño.

27. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

28. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

29. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

30. Stock market investing carries risks and requires careful research and analysis.

31. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

32. Frohe Weihnachten! - Merry Christmas!

33. Walang mangyayari satin kung hindi tayo kikilos.

34. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

35. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

36. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

37. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

38. Pagkababa, mabilis na siyang nagyayang umuwi.

39. They go to the movie theater on weekends.

40. Ah eh... okay. yun na lang nasabi ko.

41. Les devises étrangères sont souvent utilisées dans les transactions internationales.

42. Naglalaro ang walong bata sa kalye.

43. Cuídate mucho de esas personas, no siempre son lo que parecen.

44.

45. The musician released a series of singles, leading up to the release of her album.

46. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

47. The company is exploring new opportunities to acquire assets.

48. Det anbefales at udføre mindst 150 minutters moderat intensitet eller 75 minutters høj intensitet træning om ugen.

49. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

50. Lumaki si Ranay na ang trabaho ay kumain at ang libangan ay kumain parin.

Recent Searches

sumalabileryounginalalayanmapakalimalapittandatvsstonehamluistsaafrieswalletkumarimotelectionbitawansecarseinilingnasundobeforeeasyuminomparatingresourcesdebatesupworkmarkedcheckslimitrelativelynatingdarkarmeddosbabestylesitinuringboybeginninghimselfstudiedcrossoffentlignaggingbaldebinabaendipapahingaevenplanviewsdooncleanhimworkdayimprovefigureconnectionderformaseentelevisedsuchexitdowncakebroadbehalfhatingdancedinalapistamichaelhighcandidatedividesleddingginbakemind:metodeyonumilinginspiredlikelyschoolartificialnothingstagebeingmovingresponsiblepinilingbabalabanandollarhalagabringlightsmobilefurthercestrainingstanddadcleareksamaidlayuninordercalltiposbreakpreviouslyshareobstaclesabschefdulapracticadospeechimaginginternettipidpinalakingmapapawaysgubatfarstuffeddaratingoverviewemphasisrolledhowevernaiinggitferrerrestvisfascinatingtalejunioclientesconditioningsteerflythemcouldneeddigitalpetersetsclassmatepackagingmitigateamountinteligentesayanawarerougheditorscaleknowgapcharitableviewipinalutointerviewinglargecablequicklyandyincreasesambitfallacreatingseparationfrogmenutermpracticeselectedtechnologiesmultoskillryanreadbroadcastingdraft,generabalearnmakessmallnutsworkinginternacountlessimprovedpilinginternal