Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "james"

1. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

2. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

3. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

4. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

5. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

6. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

7. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

8. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

9. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

10. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

11. LeBron James is a dominant force in the NBA and has won multiple championships.

12. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

13. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

14. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

17. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

Random Sentences

1. She has won a prestigious award.

2. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

3. Masayang-masaya ang kagubatan.

4. May malawak na lupain ang kanyang mga magulang.

5. Parang ganun na nga babes. Tapos tumawa kami.

6. Nakakatakot ang paniki sa gabi.

7. Ang poot ay isang pusong nasaktan na lumalaban upang mabawi ang dangal at dignidad.

8. Bite the bullet

9. Magkikita kami bukas ng tanghali.

10. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

11. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

12. Ang kuripot mo naman, minsan lang ako magpalibre eh.

13. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

14. Matapos magbabala ay itinaas ng matanda ang baston.

15. El discurso del líder produjo un gran entusiasmo entre sus seguidores.

16. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

17. Mayroon ba kayong reaksiyon, Senador Ferrer?

18. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

19. Lasingero ang tawag sa taong laging nag-iinom ng alak.

20. Ano ang mga apelyido ng mga lola mo?

21. Protecting the environment involves balancing the needs of people and the planet.

22. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

23. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

24. Saan niyo ho ba iniisip bumili ng bahay?

25. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

26. Ang mga nagliliyab na bulaklak sa hardin ay nagbigay ng makulay na tanawin.

27. I finally finished my degree at age 40 - better late than never!

28. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

29. Ang maaamong hayop ay nagiging mailap dahil sa pananakit ni Kiko.

30. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

31. Ano ang palitan ng dolyar sa peso?

32. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

33. Masayang-masaya siguro ang lola mo, ano?

34. Nakita ng mga ibon si Paniki at tinanong siya kung bakit siya asa kanilang kampo samantalang isa naman daw siyang mabangis na hayop.

35. Natutuwa ako sa magandang balita.

36. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

37. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

38. The patient was discharged from the hospital after recovering from pneumonia.

39. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

40. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

41. Twinkle, twinkle, all the night.

42. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

43. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

44. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

45. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

46. Walang password ang wifi ng kapit-bahay.

47. Proper training and socialization are essential for a well-behaved dog.

48. Saan niya pinagawa ang postcard?

49. Ilang tao ang nahulugan ng bato?

50. Tumingala siya ngunit siya'y nasilaw.

Recent Searches

jamesnagmistulangsinabibagopag-iinatuhognagkapilatnagpuyoshimutokkumidlatkabuhayanalas-doskayabangankanluranskirtbutterflynatakotmarielmagsalitasequemaatimlakascomuneshindisiguropinakainpunong-kahoyniyanglakadbilibidmichaelsiponbakahayopsakaginoopeacenakatayopulang-pulakasiintensidadlihimvitaminngumingisitvsnakayukopresence,inventionngunitewanbumigaymagandang-magandamakamitkumakantamag-plantbusoglayuaneducationpisisisidlankapemovingtabing-dagatbinigyangtipsna-curiousgalithalaganutstilaaraynagtrabahonaalisso-calledmangiyak-ngiyakmakapagpahinganilapitannakukulilipoonglupangreorganizingaltsilaywaringkumantasalepakiramdamboracaynaglalakadpunosabianimagkabilangpangyayaritinulak-tulakstrategiesmeaningtalinonasaanexpertisenatutulogumanonaantignilolokolazadaumabotipinansasahogibonmataaasmagbayadmagkinalimutanmandirigmangannikapesospelikularabbatanawinventadomaligayakatagangmanghulipicspigingthankallottednoonmangingisdatuvoadoptedkaugnayanlightpaghahanapoutlinesibinalitangcontent,magdasinakoptravelilongmaagangwalletabstainingelectionfuncionesmakasarilingbarpetsanilutopuntaipihitimpitpagka-maktolapollotiyanakakabangonnawalapalakamayerhvervslivetpapasokaminghampaslupanagpaalamnegosyanteumiiyakpagtataposaanhinnaguguluhangdeterminasyonpagtatanongeconomynasasabihanmantikalabing-siyamnapakagagandailoilopagkabuhaybinibiyayaanpaulit-ulitspaghettilivesunuginherramientasbisigtignanwalisbabaesantoinakalangpamagathalaminu-minutomakikitulogabuhingkahongsugatangpatakbongnatuloygjort