Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "james"

1. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

2. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

3. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

4. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

5. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

6. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

7. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

8. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

9. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

10. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

11. LeBron James is a dominant force in the NBA and has won multiple championships.

12. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

13. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

14. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

17. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

Random Sentences

1. May himig pangungutya ang tinig ng pulis.

2. Piece of cake

3. Ngunit naglahong parang bula si Pinang.

4. Anong wala! pasinghal na sabi ni Aling Marta

5. Ayaw ko magtangkang magbiyahe nang walang mapa.

6. La realidad siempre supera la ficción.

7. The invention of the telephone led to the creation of the first radio dramas and comedies

8. I received a lot of gifts on my birthday.

9. Papaano ho kung hindi siya?

10. Auf Wiedersehen! - Goodbye!

11. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

12. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

13. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

14. Bale, Wednesday to Friday ako dun.

15. Supporting policies that promote environmental protection can help create a more sustainable future.

16. Kinakailangang kahit papaano'y makapag-uwi siya ng ulam sa pananghalian.

17. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

18. Está claro que hay diferencias de opinión en este asunto.

19. El amanecer en la montaña es un momento sublime que nos conecta con la naturaleza.

20. A couple of photographs on the wall brought back memories of my childhood.

21. Yung totoo? Bipolar ba itong nanay ni Maico?

22. Magtanim ka nga ng mga puno dyan sa garden.

23. Hindi ibig sabihin na kuripot ang isang tao ay madamot na ito.

24. Ang mga resort sa tabing-karagatan ay puno ng mga turista tuwing summer.

25. Suot mo yan para sa party mamaya.

26. Masama ho kasi ang pakiramdam ko.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

29. "A dog's love is unconditional."

30. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

31. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

32. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

33. Biglang bumangon ang hari at hinugot ang espada.

34. She is cooking dinner for us.

35. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

36. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

37.

38. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

39. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

40. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

41. Ano ang kulay ng paalis nang bus?

42. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

43. He has been to Paris three times.

44. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

45. Nang dumalaw muli ang kanyang ama, pinatawad na niya ito at maging ang kanyang ina ay tuluyang gumaling at napatawad pa rin ang asawa.

46. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

47. The birds are not singing this morning.

48. Gumawa ng pangit na drowing ang kaibigan ko.

49. Ang pagkakaroon ng sapat na tulog ay nagbibigay ng malinaw na pag-iisip at pagiging masigla sa bawat umaga.

50. The wedding photographer captures important moments and memories from the wedding day.

Recent Searches

jameslumilipadhigh-definitionpanginoonmakatulogjoshuakumalmalumikhapresidentengayomagkasabaymag-aaralnanghurtigerenucleariwanrenacentistakisapmatawalahumingimagdadapit-haponsectionsresultmulighederraiseetosinonaiinisbilihintelebisyonannaganungloriavarietybisitatitaattorneynakikini-kinitapakistanbibisitanagtrabahotalagadumilimmulanobodyarghkasamaangpaglalaitbwahahahahahapalangmaskaranearlangkaykagandahanmamanhikanfeelpiyanoyamanmangingisdangkommunikerertopicnakakadalawmiramejoinastatamadkagabipangettinanggalsabadnammaibigaypaglalabalipatpasaheh-hoynabiawangnakakatandanangampanyadyipgumagamitentrancepositibopagkahapolikesbatoknaglulutokargahanbroadinantaymahiyanakapapasongnatagalankainitankalongnagkabungailihimanimouwakhinigitpetsamakahingipanitikan,edsanabigkastekabumabaahasvispasalamatanbinataksinumangtunayhinabibundokunconventionalexhaustedlibrenangangaralnagbabaladisposalibigfertilizergawingsamalargerbaulkahaponhelpguidanceaidpeterpagbahingsparksharingwriting,breakmakaratinginimbitachadboyfriendubodricapasensiyanakahainsinaliksikfiverrpaghabakasalnakahantadmananaige-booksrambutanpokersweetempresaspublicationtenidooktubreobstaclesnakakaanimlondondumagundongbabesvitaminnameafternabalitaaninyokapeteryabayangnuevoslumiwanagpalabuy-laboykaaya-ayanglittlepalasyomagdoorbellkwartobutilnageespadahannaglakadplannakakasamapeksmanrobinhoodnatatanawpagdukwangganyansimbahahiligaayusinsummer10thmagpa-picturebinilhanbalotiniibigmaliniskuripot