Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "james"

1. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

2. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

3. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

4. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

5. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

6. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

7. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

8. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

9. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

10. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

11. LeBron James is a dominant force in the NBA and has won multiple championships.

12. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

13. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

14. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

17. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

Random Sentences

1. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

4. Many financial institutions, hedge funds, and individual investors trade in the stock market.

5. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

6. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

7. Kakutis ni Kano ang iba pa niyang kapatid.

8. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

9. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

10. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

11. Nabigla ako sa tanong nya kaya sinapak ko sya.

12. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

13. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

14. Baka naman nag message na sayo, hinde mo lang alam..

15. Tumayo siya tapos nagmadaling pumunta sa cr

16. Hindi naman sa ganun. Kaya lang kasi...

17. However, there are also concerns about the impact of the telephone on society

18. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

19. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

20. Oo, malapit na ako.

21. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

22. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

23. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

24. Eh? Kelan yun? wala akong maalala, memory gap.

25. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

26. Dumating na ang araw ng pasukan.

27. Naramdaman ko ang kalungkutan na unti-unti nang napawi nang matanggap ko ang magandang balita.

28. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

29. Thanks you for your tiny spark

30. Puwede bang makausap si Clara?

31. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

32. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

33. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

34. Taos puso silang humingi ng tawad.

35. Napahinto siya sa pag lalakad tapos lumingon sa akin.

36. Nag-aaral ako para sa aking mga eksaminasyon, bagkus ang mga kaibigan ko ay nag-aaya ng lakad.

37. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

38. Before television, most advertising was done through print media, such as newspapers and magazines

39. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

40. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

41. A lot of time and effort went into planning the party.

42. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

43. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

44. Minabuti nilang ilihim nila ito sa kanilang anak.

45. Muntikan na akong mauntog sa pinto.

46. Dapat kong bilhan ng regalo si Maria.

47. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

48. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

49. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

50. Hindi na sila nasisiyahan sa nagiging asal ng bata.

Recent Searches

jameslalobiocombustiblesnamumulaklakpagkalungkotmagsalitalolatherapynakapasokpamanhikansasamahanmaisusuotcourtpaligsahanpahiramnasunoggregorianokauntimatutongabigaelvidenskabmagsunoglumisanpaglalayagspeedkatagangheartbeatinspiretelavampiressufferisiptools,inangleadingayokotwitchwalletcongratsoutlineskararatingmapadaliputiharmfuleducationalmakipag-barkadabatokbutchcoachingnagtrabahopamilyangiintayinmahihirapnangapatdannapasigawnakuhagumapangpagbigyanintensidadroonnanonoodmasaktankalabankainantindahaniconsmatapangpatiencedemocracyhanfrogeitheremphasisochandobumabasofanariningbasamemorialdagatingbilinkabibihismisaabonokerbulambabesbusyangtahimikgumuhitrodonaunidosngumingisinalamanmaintindihanpagkaraanaglokokongresomabagalseguridadkinakitaannapakamisteryosomagbagong-anyomedicinegobernadorkinamumuhianhinagud-hagodmakauuwimakikitanakapangasawatabing-dagatmagkikitatokyopondomagpakasalnaguguluhaneskuwelanapapasayanagsagawapaglalabadadekorasyonmensajeskatawangcultivarmakahiramnapakahusaynapaluhasabadongnagwelgapagpapasannangangahoymagpaniwalakaloobangtravelerpresidentialnalalabingtemparaturagumawamakasalanangmagkaharapnagdiretsopaki-chargepangungusapmatagpuantinaypakilagaykamaliantanyagnabigaycaracterizanagwalismagselosumangatika-50tulisaniyamotbopolsnakakapuntanatigilanmatangkadfreedomsnahantadnagplayobservation,utilizanpanatagkonsyertofavorkaarawaneducationcarbonfulfillingcharismaticbateryatiningnansumingittinikmakinangumalispangkattamishimayinmatesamachinespromotekailanpersonquarantineadmiredbalinganfederalangkingnunocelulareskatandaanfionamakahingibingi