Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "can"

1. "A dog is the only thing that can mend a crack in your broken heart."

2. "Dogs are like potato chips, you can't have just one."

3. "You can't teach an old dog new tricks."

4. A balanced and healthy diet can help prevent chronic diseases.

5. A father's love and affection can have a significant impact on a child's emotional development and well-being.

6. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

7. A wedding planner can help the couple plan and organize their wedding.

8. A wife can be a source of emotional and physical intimacy for her husband.

9. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

10. Accomplishing a long-term goal can create a sense of euphoria and relief.

11. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

12. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

13. Adequate fiber intake can help regulate the digestive system and maintain gut health.

14. Adopting a pet from a shelter can provide a loving home for an animal in need.

15. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

16. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

17. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

18. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

19. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

20. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

21. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

22. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

23. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

24. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

25. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

26. Ailments can be a source of stress and emotional distress for individuals and their families.

27. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

28. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

29. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

30. Ailments can be managed through self-care practices, such as meditation or physical therapy.

31. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

32. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

33. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

34. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

35. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

36. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

37. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

38. Ailments can range from minor issues like a headache to serious conditions like cancer.

39. Ant-Man can shrink in size and communicate with ants using his helmet.

40. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

41. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

42. Apa yang bisa saya bantu? - How can I help you?

43. Baby fever can affect people of various ages, backgrounds, and genders.

44. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

45. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

46. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

47. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

48. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

49. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

50. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

51. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

52. Can you please stop beating around the bush and just tell me what you really mean?

53. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

54. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

55. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

56. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

57. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

58. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

59. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

60. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

61. Cancer can impact individuals of all ages, races, and genders.

62. Cancer can impact not only the individual but also their families and caregivers.

63. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

64. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

65. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

66. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

67. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

68. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

69. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

70. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

71. Climbing to the top of a mountain can create a sense of euphoria and achievement.

72. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

73. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

74. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

75. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

76. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

77. Cryptocurrency can be used for both legal and illegal transactions.

78. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

79. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

80. Cutting corners in your exercise routine can lead to injuries or poor results.

81. Cutting corners on food safety regulations can put people's health at risk.

82. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

83. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

84. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

85. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

86. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

87. Dogs can be trained for a variety of tasks, such as therapy and service animals.

88. Dogs can develop strong bonds with their owners and become an important part of the family.

89. Dogs can provide a sense of security and protection to their owners.

90. Dogs can provide emotional support and comfort to people with mental health conditions.

91. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

92. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

93. Don't underestimate someone because of their background - you can't judge a book by its cover.

94. Eating a balanced diet can increase energy levels and improve mood.

95. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

96. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

97. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

98. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

99. Effective use of emphasis can enhance the power and impact of communication.

100. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

Random Sentences

1. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

2. Ang pag-asa ay nagbibigay ng positibong pagtingin sa buhay at mga pangyayari kahit na may mga suliranin at pagsubok na kinakaharap.

3. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

4. Sa katagalan ng panahon ang lawa ay natuyo at may tumubong isang puno.

5. Inflation kann auch durch politische Instabilität verursacht werden.

6. Break a leg

7. Ibibigay kita sa pulis.

8. Umayos naman ako ng higa at yumakap patalikod sa kanya.

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. All these years, I have been building a life that I am proud of.

11. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

12. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

13. She is not drawing a picture at this moment.

14. Hindi man nanalo sa halalan, bagkus ay binati pa rin nang natalong kandidato ang bagong mayor.

15. En la realidad, las cosas no son siempre en blanco y negro.

16. I am teaching English to my students.

17. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

18. Sa mga bundok, ang mga mountaineer ay nagtatanim ng puno upang mabawasan ang pagkaagnas ng lupa.

19. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

20. Berbagai lembaga dan organisasi keagamaan berperan aktif dalam memberikan pelayanan sosial, pendidikan, dan bantuan kemanusiaan bagi masyarakat Indonesia.

21. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

22. Ang mumura ng bilihin sa divisoria.

23. pagkaraan ng kargang iyon ay uuwi na siya.

24. Natalo ang soccer team namin.

25. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

26. Ano na nga ho ang pamagat ng palabas ninyo?

27. Anong nangyari sayo? Bakit hinde ka nagkakakain?

28. Ada berbagai macam jenis doa, seperti doa harian, doa syukur, doa permohonan, dan lain sebagainya.

29.

30. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

31. Hindi naman, kararating ko lang din.

32. Natapakan ako ni Juliet habang sumasayaw.

33. Ang mga ngipin na hindi naipapatingin sa dentista ay maaring magdulot ng iba't ibang sakit sa bibig.

34. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

35. Dapat akong bumili ng regalo para kay Maria.

36. Los océanos contienen la mayor cantidad de agua en la Tierra.

37. La contaminación del agua es un problema grave que afecta la calidad y disponibilidad del agua.

38. The patient's family history of high blood pressure increased his risk of developing the condition.

39. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

40. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

41. Nasira ang kanyang sasakyan dahil sa isang aksidente sa kalsada.

42. Mangiyak-ngiyak siya.

43. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

44. Kailan at saan ipinanganak si Rene?

45. Saan itinatag ang La Liga Filipina?

46. Yey! Thank you Jacky! The best ka talaga!

47. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

48. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

49. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

50. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

Similar Words

CanadacanteenAmericancancersignificantcandidatescantocomunicancantidadRepublicancandidategratificante,

Recent Searches

espadacansinongrobotichulingprotestabowthemconsiderardecisionsbumababubonggalitthirdsyncdoeshateoftenformatamazonstyrermanagerpilingconsidertaon-taonmarilouwidespreadcontinuedmananalonapatulalanasanahahalinhaneksport,varietytrajesukatdiagnosesnangyayaricassandranaglalabaninongcompositoreshundrednanlilisikmatalinotopiclargeledpromotenagwelganakumbinsianak-pawisinvesting:napapansintumatawadmagturopisaranalugodtrentabiglasisidlanpinalayasyamansueloanibinabaliksingeralinthroughoutsamahanlangkayhumpaydollarallowingdiedmakawalasiksikanpagkaangatmapaikotproudedsanayonmangkukulampamanhikannagpapakainnalalamannangampanyamaglalakadnakaupoikinamataynakakitanamumulaklaknagkapilatkinauupuannagpabayadnagkwentonakakagalaumiiyakpagsalakaysasayawinwastesulyaptumatanglawnaabutannagtalagasasamahanpagkagustotagtuyotuusapanmagpapigilmakabawikontratapagkaraamensahenakakainpahirampresidenteuniversitymaghihintayunidosmarketing:pamagatkolehiyotahimiknakisakaymatagumpaykarapatangkapatagannglalabamatumalrodonabinge-watchingpagsusulitfreedomsuniversitiesmaluwaghinatidpananakitmusicniyogkaharianpagmagsimulamatangumpaypinilitperseverance,maramotlalimminahanginaanghelsadyangkendibuwayasayapaggawakaniyarobinhoodibigaykasakitpresleymalapitanganidkasamaexpresansaleskutodhumayotapewalongstruggledbasahinmalumbayelectoralsineroselleremain1787lagimassesmeaningitinagomakasarilinglettertherapysumarapleukemiaconvertidasmisabecomeleocupidbiyerneskinagalitanataoperatepedejamescoaching:magbunga