Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "can"

1. "A dog is the only thing that can mend a crack in your broken heart."

2. "Dogs are like potato chips, you can't have just one."

3. "You can't teach an old dog new tricks."

4. A balanced and healthy diet can help prevent chronic diseases.

5. A father's love and affection can have a significant impact on a child's emotional development and well-being.

6. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

7. A wedding planner can help the couple plan and organize their wedding.

8. A wife can be a source of emotional and physical intimacy for her husband.

9. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

10. Accomplishing a long-term goal can create a sense of euphoria and relief.

11. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

12. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

13. Adequate fiber intake can help regulate the digestive system and maintain gut health.

14. Adopting a pet from a shelter can provide a loving home for an animal in need.

15. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

16. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

17. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

18. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

19. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

20. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

21. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

22. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

23. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

24. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

25. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

26. Ailments can be a source of stress and emotional distress for individuals and their families.

27. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

28. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

29. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

30. Ailments can be managed through self-care practices, such as meditation or physical therapy.

31. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

32. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

33. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

34. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

35. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

36. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

37. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

38. Ailments can range from minor issues like a headache to serious conditions like cancer.

39. Ant-Man can shrink in size and communicate with ants using his helmet.

40. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

41. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

42. Apa yang bisa saya bantu? - How can I help you?

43. Baby fever can affect people of various ages, backgrounds, and genders.

44. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

45. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

46. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

47. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

48. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

49. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

50. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

51. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

52. Can you please stop beating around the bush and just tell me what you really mean?

53. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

54. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

55. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

56. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

57. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

58. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

59. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

60. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

61. Cancer can impact individuals of all ages, races, and genders.

62. Cancer can impact not only the individual but also their families and caregivers.

63. Cancer survivors can face physical and emotional challenges during and after treatment, such as fatigue, anxiety, and depression.

64. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

65. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

66. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

67. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

68. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

69. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

70. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

71. Climbing to the top of a mountain can create a sense of euphoria and achievement.

72. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

73. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

74. Completing a difficult puzzle or solving a complex problem can create a sense of euphoria.

75. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

76. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

77. Cryptocurrency can be used for both legal and illegal transactions.

78. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

79. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

80. Cutting corners in your exercise routine can lead to injuries or poor results.

81. Cutting corners on food safety regulations can put people's health at risk.

82. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

83. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

84. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

85. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

86. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

87. Dogs can be trained for a variety of tasks, such as therapy and service animals.

88. Dogs can develop strong bonds with their owners and become an important part of the family.

89. Dogs can provide a sense of security and protection to their owners.

90. Dogs can provide emotional support and comfort to people with mental health conditions.

91. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

92. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

93. Don't underestimate someone because of their background - you can't judge a book by its cover.

94. Eating a balanced diet can increase energy levels and improve mood.

95. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

96. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

97. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

98. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

99. Effective use of emphasis can enhance the power and impact of communication.

100. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

Random Sentences

1. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

2. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

3. Ang mahal na ng presyo ng gasolina.

4. Lumiit ito at nagkaroon ng mga mahahabang paa.

5. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

6. Tumagal ng ilang minuto bago natapos ang palabas.

7. Masyadong mababaw ang tubig sa tabing-dagat.

8. May pitong taon na si Kano.

9. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

10. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

11. Palaging sumunod sa mga alituntunin.

12. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

13. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

14. Sumakay ako ng taxi sa hatinggabi upang umuwi.

15. En España, el cultivo de la vid es muy importante para la producción de vino.

16. Many charitable institutions rely on volunteers to sustain their programs.

17. Las heridas infectadas pueden requerir de antibióticos para su tratamiento.

18. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

19. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

20. Linggo ng umaga at ang palengke ay siksikan.

21. Ilan ang batang naglalaro sa labas?

22. A couple of students raised their hands to ask questions during the lecture.

23. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

24. He makes his own coffee in the morning.

25. Ang pag-iwas sa mga diskusyon at pagtatangkang itago ang mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

26. The project is taking longer than expected, but let's hang in there and finish it.

27. Sa isang iglap siya naman ang napailalim.

28. She is not cooking dinner tonight.

29. Matagal akong nag stay sa library.

30. Bakit sila nandito tanong ko sa sarili ko.

31. La música es una parte importante de la educación musical y artística.

32. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

33. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

34. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

35. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

36. Le livre que j'ai lu était très intéressant.

37. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Naghanda sila para sa kasal na gagawin sa bundok.

40. Ang kanyang pagkanta ay animo'y pumapasok sa puso ng mga nakikinig.

41. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

42. Pakitimpla mo ng kape ang bisita.

43. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

44. Kahit ubuhin sila sa nakasusulasok na mga basura, araw at gabing nagbantay ang mga taong bayan at mga kawal.

45.

46. Environmental protection requires a long-term vision and commitment to future generations.

47. Ella yung nakalagay na caller ID.

48. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

49. Ang hirap maging bobo.

50. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

Similar Words

CanadacanteenAmericancancersignificantcandidatescantocomunicancantidadRepublicancandidategratificante,

Recent Searches

canroboticdolyardaigdigdaratingbrideiosilanpupuntaregularmentemaputistylesdigitalmovingbakeguidetoolheftybangkaupworkhimayintinikcompletingsumugodcalambaestadosnahawakannilaospabililamankaagawengkantadaheartbreakinatakepagsisisilubospusonagagandahanpakaininreadersmiyerkulespalapagnakayukoaddresselepantepagmamanehopalamutimagkaibigannananaginippodcasts,nagpapaigiblaki-lakinakagawianfarusowatawatmarunongdiliginnatanongpinangalananmabagalvidtstraktonline,mamahalinopisinagiyerasimbahannakatirapagsalakayeskwelahantravelerpagngitipagkakalutomisteryopagodunattendednagbantayfestivalesna-suwaypinamalaginakangisinag-angatmakapagsabimateryalesmakabawimedicaldiwatamaisusuotgumawamasaksihannangahasaga-agamagdaraostungkodtumikimgawindispositivonakataastahananpagmasdansarisaringnawalakinakaininiresetacaracterizasiopaodamdamindealmakabalikniyankababalaghangnakainpesomatandanghinatidnaglulusaknagcurvemagpuntabagalkasoynapakophilosophicalgulangpositibosarongbumigayutilizardailymerontelefonpamimilhingninyoambagcelularessamakatwidedukasyonnunowalonggoalsupilinhugismedyongayonmataaaslumusobsusunodnaulinigangreatconsistgathering1000tuwingdulotonlinejoedalawadoonmusicalriskjustcardvampirescollectionsbalingbuwanarghlawsgraduallysquatterneedbowconditioningeasystanddarkkalimutanstorerolledthereforesulinganpollutiontabiadventcomplicatedinterestmulididaddingsourceputingsettingcuandocontrolledcommercebeyondrelevantexperts,kissilangahit