Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "too"

1. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

2. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

3. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

4. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

7. The momentum of the train caused it to derail when it hit a curve too quickly.

8. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

9. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. The students are studying for their exams.

2. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

3. Mabait sina Lito at kapatid niya.

4. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

5. Opo. Ano pong kulay ang gusto ninyo?

6. Dime con quién andas y te diré quién eres.

7. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

8. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

9. Hindi umano totoo ang mga balitang nag-resign na ang presidente ng kumpanya.

10. Hindi dapat tayo sumuko sa agaw-buhay na laban sa kahirapan.

11. Ang digmaan ay maaaring magdulot ng pagkasira ng mga kultura at tradisyon.

12. She helps her mother in the kitchen.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

15. Matagal akong nag stay sa library.

16. Sa ilang saglit ang matandang babae ay naglaho at ang lugar na dating kinatitirikan ng kanyang bahay ay naging lawa.

17. Maraming guro ang nagbigay ng suhestiyon ukol kay Beng.

18. Bakit anong nangyari nung wala kami?

19. Bagaimanakah kabarmu hari ini? (How are you today?)

20. Kailangan ng sapat na pagpaplano upang maipon ang sapat na pera upang mabayaran ang utang sa tamang panahon.

21. Dumating ang pangulo sa pagtitipon.

22. I sent my friend a bouquet of flowers and a card that said "happy birthday."

23. She had been studying hard and therefore received an A on her exam.

24. Napakabuti nyang kaibigan.

25. Ang laman ay malasutla at matamis.

26. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

27. Bakit lumilipad ang manananggal?

28. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

29. Los bebés recién nacidos tienen un olor dulce y tierno.

30. Tumingin ako sa bedside clock.

31. Les banques jouent un rôle clé dans la gestion de l'argent.

32. Lalong nag-iyakan ang dalawang bata.

33. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

34. Palibhasa ay madalas na may mga kahanga-hangang insights dahil sa kanyang malalim na pag-unawa.

35. Ang mumura ng bilihin sa Shopee.

36. I am not working on a project for work currently.

37. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

38. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

39. Ang bata ay takot na nakatingin sa kanya.

40. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

41. Masaya akong pumasok sa silid-aralan dahil mahilig ako sa pag-aaral.

42. Kumikinig ang kanyang katawan.

43. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

44. The stockbroker warned his client about investing in risky assets.

45. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

46. Tengo escalofríos. (I have chills.)

47. Pinoy pride ang dala ng mga atleta natin sa bawat laban.

48. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

49. Aalis na ko mamaya papuntang korea.

50. Mahilig siyang mag-ehersisyo at kumain ng masustansya, samakatuwid, malakas ang kanyang pangangatawan.

Similar Words

totootoothbrushtotoongtooltoolstools,

Recent Searches

tooinfluentialsedentarycomunestuwidstrengthinternaworkingflyventalockdownexitsusunodkasingcallingstyrerryanmenuanubayanpag-aaraldecreasediikutankainmartesagilitywaribobopagsigawitinatapattahanankailangannapagodalituntuninbagkusnangingitngitkabighaantesrisetinikaudienceiiwasanpromotesundhedspleje,sayanatigilannag-iyakankomunikasyonnakakabangontiismatalinopanghihiyangiiwanclientespangyayaripamanflyvemaskinerhiwagabidiretsahangkumikiloshiskidkiranmemoryyumaopumapasokitinalagangaffiliateiloilonalalabingprivatevarietyo-onlineprimerosmaruruminaiiritangmagpakaramibumaligtadculturasvidenskabnoonggulangpangakomartialsisidlanninyofauxanywheretignanaanhinreducedseriousailmentshallbinabalikcollectionseksenaofferagoskawayanbadingsingeralinlargefirstprogrammingnagbiyayangayonmagsasamasumusunonag-iisipnagtakatuyongnakaririmarimkwelyoinagawkinumutannananaloibinalitangkongresomagpasalamatumingitearnlihimpopcornpanigdaratingnagtungosambitpare-parehoplantarkonsentrasyonsaranggolasompunongkahoymusicfitnessmedikalmahinogaplicacionesprimerhigitestadosmaawaingdescargargusaliopportunityginatatlonapakaadvancementagricultoresnakapangasawapinag-usapantuluyannagmamadalimumuraeskwelahannakapagusapcandidatenakatayokumbinsihinmagkakailajosefaunattendedhumiwalaypinakamahabamakalipasumakbaykinalalagyannangangakonakabibingingsensiblemagingnaaksidentenakatuontungkodmagdaraostungopabilitransportnglalabavitaminpakukuluanestasyonkumampiisinuotmagtatakanatanongpalamutibinentahanpagkabuhaywinssinakophelpedmaibalikhabitnilapitanlayuankababayantagalog