Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "too"

1. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

2. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

3. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

4. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

5. The bag of groceries was too hefty for the elderly woman to carry on her own.

6. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

7. The momentum of the train caused it to derail when it hit a curve too quickly.

8. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

9. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

2. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

3. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

4. Umihip ang malamig na hangin, waring may paparating na masamang balita.

5. Oy saan ka pupunta?! sigaw nya.

6. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

7. She writes stories in her notebook.

8. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

9. Iiyak ako pag hindi ka pumayag maging bestfriend ko.

10. Exercise can be tough, but remember: no pain, no gain.

11. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

12. The invention of the telephone and the internet has revolutionized the way people communicate with each other

13. El agua se utiliza en actividades recreativas, como la natación, el surf y la navegación.

14. Tengo tos seca. (I have a dry cough.)

15. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

16. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

17. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

18. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

19. Ginawa niya ang lahat ng makakaya niya sa kompetisyon, samakatuwid, walang dahilan para siya ay malungkot.

20. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

21. The community admires the volunteer efforts of local organizations.

22. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

23. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

24. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

25. Anong oras nagbabasa si Katie?

26. Napakagaganda ng lumahok sa beauty pageant.

27. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Ang agila ang pambansang ibon ng Pilipinas.

30. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

31. Det er vigtigt at huske heltenes bedrifter og lære af dem.

32. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

33. You can't judge a book by its cover.

34. Ang oxygen ay kailangan ng tao para mabuhay.

35. A successful father-child relationship often requires communication, patience, and understanding.

36. Kelangan ba talaga naming sumali?

37. Sarado ang eskuwela sa Sabado at Linggo.

38. Nag-reply na ako sa email mo sakin.

39. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

40. Nakakapagod pala bumaba ng bundok.

41. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

42. Kumaliwa ka sa susunod na kanto.

43. Ignorieren wir unser Gewissen, kann dies zu einem Verlust unseres moralischen Kompasses führen.

44. Microscopes are also used in materials science and engineering to study the microstructure of materials.

45. Nationalism can be a source of inspiration for artists, writers, and musicians.

46. Baka nga si Amba pa gumawa ng tela aniya.

47. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

48. Sino ang doktor ni Tita Beth?

49. Tinawag nya kaming hampaslupa.

50. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

Similar Words

totootoothbrushtotoongtooltoolstools,

Recent Searches

tooplaysenergymagbubungadigitalnagbibigaywaterdagligemagsalitapagkakatayokawili-wilipagbebentacultivationtinungogospeltemperaturaamericalalabasmasyadongdistancianagpalutopagtiisanpanghabambuhaysaranggolaressourcernekagandahagkadalagahangnakapangasawaguidekinabubuhaykarunungancultivapagkahapopalabuy-laboypaglalaitnegosyantemakangitinasasakupannagtuturokomunidadnaiilaganmagkaharapnakatulognaibibigayinsektongbalitanaglakadsaritafollowing,tinangkathanksgivingnaghihiraplabinsiyamkaninumankomedorsasakyanseguridadhalu-halonaliwanaganinaaminhumahabatitamulti-billionilagayshiftnangingisaylalarganangangalogmaynilaisasamapakistangovernorssignalgawainbulalasnaiiritangwonderpakainincandidateslittlehinukaygustongunangkonsyertoejecutanmatutulogcarolsisterisinalaysaykargangofrecenmayabongasiaperwisyomaghintaybulonge-commerce,carmenmarmaingadvancerisegardenskyldesbigongpagputibinanggaalasanahinigitprutasleadingaumentarpriestsupilinpogisikosusulitmatapospaskongusamestultimatelypierhusographicmournediniinomtsekasingtigasspeciallatesttenderspeechesharingbriefmulighedvasquesngitidumatingpakainshowsseestorehariclasesagosanipetsacuentanelectionsflexibleprobablementemabaitkumakantainvolvecreationguiltysquatterpowersroquebabebehindupworkipinagbilingteamstringmakapilingprocessattacksolidifyulingwaitbinilingrefreturnedanothergaanokahilingannagkwentotoolspagdukwangmaramihinimas-himasipakitagalitilannovelleshahatolpapanhiklumakassasakaycommunitynilaoshinanakithinagisnatatanawginhawakasakitfatherunconstitutional