Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "global"

1. International cooperation is necessary for addressing global environmental challenges, such as climate change.

2. It is an important component of the global financial system and economy.

3. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

4. Scientific evidence suggests that global temperatures are rising due to human activity.

5. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

6. The company's acquisition of new assets will help it expand its global presence.

7. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

8. The momentum of the economy slowed down due to a global recession.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. The stock market can be influenced by global events and news that impact multiple sectors and industries.

11. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

12. The United States is the world's largest economy and a global economic superpower.

13. These films helped to introduce martial arts to a global audience and made Lee a household name

14. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

15. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

Random Sentences

1. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

2. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

3. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

4. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

5. Isang babae na mahaba ang buhok na kulot, nakablue gown sya.

6. Kailangan kong tapusin ang ginagawa ko.

7. Sino yung naghatid sayo? biglang tanong niya.

8. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

9. Oo naman. I dont want to disappoint them.

10. En la universidad, hice muchos amigos nuevos de diferentes partes del mundo.

11. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

12. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

13. Isang beses naman ay ang sandok ang hinahanap.

14. Samantala sa pag-aaral, iniinda niya ang mga pagsubok sa buhay.

15. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

16. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

17. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

18. Gracias por tu amabilidad y generosidad.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Ang pag-aaral ng panitikan ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

21. Bakit ba gusto mo akong maging bestfriend?!

22. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

23. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

24. Confocal microscopes use laser technology to create 3D images of small structures.

25. May nakita ka bang maganda? O kabigha bighani?

26. A couple of friends are planning to go to the beach this weekend.

27. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

28. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

29. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

30. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

31. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

32. The two most common types of coffee beans are Arabica and Robusta.

33. Ang sigaw ng matandang babae.

34. Emphasis can be used to persuade and influence others.

35. Nakaka-bwisit talaga ang nangyari kanina.

36. The basketball court is divided into two halves, with each team playing offense and defense alternately.

37. El agua dulce es un recurso limitado y debemos cuidarlo y utilizarlo de manera sostenible.

38. Las heridas en zonas sucias o contaminadas pueden aumentar el riesgo de infección y requerir una limpieza más exhaustiva.

39. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

40. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

41. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

42. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

43. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

44. The government is working on measures to reduce traffic pollution in urban areas.

45. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

46. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

47. Sa gitna ng parke, nahanap namin ang lilim ng malalaking puno na perpekto para sa aming piknik.

48. Football is played with two teams of 11 players each, including one goalkeeper.

49. Maraming bayani ang naging simbolo ng pag-asa at inspirasyon sa panahon ng krisis at kahirapan ng bayan.

50. Sinabi naman ni Apollo ang mga dapat gawin.

Similar Words

globalisasyon

Recent Searches

colorglobalpulang-pulamalawakpasangkatulongelenaalas-dosenegativeshoppinglilimkolehiyomagtakaattentionhapag-kainanpitongdilawreaddrinksyourdeliciosaguerrerounakinasisindakanbobomaskinerespigasnagsiklabamerikaforcesrimasdagligemaalwangpangambatarangkahanmagkasamawantandoylupainmatanag-iisanakagawiangawanpinagsulattumawanamumulaklakgasolinaubodtig-bebentepositibotillyayaprovemakabalikbatokmakulitnyeengkantadapasanmarsoinfluencesapatnapugranlalabascupidumupoinabutanhihigiteleksyonnasasalinannagpapaigibamountnasaanhulupakilutophilosophicalracialtelefonerinuulamduonipinadakiptiyaktinatawagnagtrabahopinapasayanakasahodturismostocksmagasawangfaktorer,pakistantransport,gumagalaw-galawvidenskabenkabutihanopokumbinsihincountlesspagtangissawsawanumalisdidingzoommanalojackyfacebookisinalaysaypedeintramurosconectadosvaliosasapatpagsayadeksamydelseralaalakalakingthereforemanamis-namisdoonsurgerymaynilamatapangwellkagipitanbenefitsparinlayawpisngimaranasankawili-wiliisinarahelenalumiitgumisinggalitkainanrambutansalarinpinapatapos1980halikanakaakmapaghihingaloatevetonagbabakasyonmayroongbumangonnakilalabunutanpagkalitopumupurikunenagyayangmayamangantoniohumihingikauntilandlinekuligligalagangmganunsolarnababakasmagpagalingtsuperhagdanltonapakagagandasiyudadgustopampagandaintensidadmadulaskamatisngingisi-ngisingreynanamumukod-tangibumabadahanaksidentefitdinadaananideamakakawawacomputere,gitanasexitcurrentbaldengwifinagtuturozoosameincludeisamamisuseddouble