Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "global"

1. International cooperation is necessary for addressing global environmental challenges, such as climate change.

2. It is an important component of the global financial system and economy.

3. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

4. Scientific evidence suggests that global temperatures are rising due to human activity.

5. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

6. The company's acquisition of new assets will help it expand its global presence.

7. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

8. The momentum of the economy slowed down due to a global recession.

9. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

10. The stock market can be influenced by global events and news that impact multiple sectors and industries.

11. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

12. The United States is the world's largest economy and a global economic superpower.

13. These films helped to introduce martial arts to a global audience and made Lee a household name

14. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

15. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

Random Sentences

1. Lord, Wag mo muna siyang kunin..

2. Nakita kita kanina, at nagtataka ako kung sana pwede ba kita makilala?

3. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

4. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

5. Hindi ko kayang itago ito, gusto kong malaman mo na sana pwede ba kitang mahalin?

6. Ituturo ni Clara ang tiya niya.

7. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

8. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

9. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

10. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

11. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

12. Ang aming angkan ay mayroong mga natatanging tula at awitin.

13. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

14. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

15. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

16. Gumagalaw-galaw ang sabog na labi ni Ogor.

17. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

18. The phone rang late at night, and therefore she was hesitant to answer it.

19. Pasensya na, kailangan ko nang umalis.

20. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

21. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

22. Ang paggamit ng droga ay maaaring magdulot ng pagkakasala, tulad ng paglabag sa batas at pagiging sangkot sa mga krimen.

23. Magsusunuran nang manukso ang iba pang agwador.

24. They are singing a song together.

25. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

26. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

27. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

28. Ikaw pala, Katie! Magandang hapon naman.

29. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

30. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

31. Some limitations can be temporary, while others may be permanent.

32. Kung may mananagot niyan ay walang iba kundi ang pobreng tsuper.

33. Las serpientes mudan su piel periódicamente para permitir su crecimiento y eliminar parásitos.

34. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

35. The decision to release the product early was a risky but ultimately successful strategy.

36. Sa wakas sinabi mo rin. aniya.

37. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

38. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

39. Dahil malilimutin ako, nakalimutan ko na naman ang pangalan ng bagong kaklase.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

42.

43. Ang albularyo ay nagdasal habang minamasahe ang namamagang braso ng pasyente.

44. Naglipana ang mga ibon sa hardin ngayong tag-araw.

45. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

46. Hindi nakakatuwa ang mga taong nagpaplastikan dahil hindi nila nilalabas ang totoong nararamdaman nila.

47. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

48. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

49. Saan ka nakatira? ang tanong ng pulis.

50. Kung maka-yo 'tong next partner ko kala mo taga kanto.

Similar Words

globalisasyon

Recent Searches

higitseekklimaglobalbilinulamusabarnesbinibiniterminotumulongpagkamanghamanuelcharminggandagodpasanginisingmatangalingrailipapainitshapingtabibosesfloorpupuntakararatingcomewalletmalapitandylearnroughcon2001guiltyrightpreviouslystandhalikareboundexperienceseventsmahuhusaypalantandaanpaki-translatekanilapangungutyakasinagagamitnagmamaktolraymondmasukolipasokhinabolnangahasmerebutikisurgerykaninumannandayanagmistulangnapakatagalkoronapatinanamanpagbabayadpaglingonlabasbumilikumapittiyaadvancedtulodevelopmenttinderakangitanmagbalikhalamanmakalaglag-pantysponsorships,distansyakawili-wiliouenanalokapitbahaynasagutannai-dialmaghahabinagbabalasasakayphysicalbayadmusiciansnapapikitpelikulapagdamihumpayguidancenakatinginabat-shirtuusapanmagsi-skiingminamahalnahintakutanpansamantalapagdukwangtinangkapagkuwapamamasyalpinagtagpobibisitanakalagayagam-agamnaglulutopagkainislandlineartistmagsasakadyipnisinusuklalyanmagtagopagkaawaumiimikmagtatanimkaibiganthanksgivingalinunankaratulangtrentamismokainitanmantikasumalakayleadersgawinghinagisbinabarattiniklingpagiisipnabigaytsinanatitiramerchandisemisteryokamotebinawiansigurovelfungerendeexpresanumaliskasalananpublicationmagigitingwasakmataaswednesdayipantalopflaviodogsdinanaspalaymininimizeosakamangenumerosasramdambeginningsreplacedtransmitidaspierupoiniwangabereduceduncheckedcontent,misusedjackzeliteibalikmaintindihanmultorawleftcommerceinteriorfacilitatingalearmeditlogitinalisincepangulodrewyanlegislative