Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "career"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

4. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

5. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

6. In addition to his musical career, Presley also had a successful acting career

7. Limitations can impact one's career, relationships, and overall quality of life.

8. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

9. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

10. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

11. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

12. The uncertainty of the job market has led to many people rethinking their career paths.

Random Sentences

1. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

2. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

3. The pretty lady in the park was surrounded by admirers.

4. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

5. Nag shopping kahapon si Tita sa SM.

6. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

7. Bumisita ako sa lola ko noong Mayo.

8. Sa aming eskwelahan, ang mga mag-aaral ay nagtatanim ng mga gulay sa school garden.

9. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

10. La brisa movía las hojas de los árboles en el parque.

11. Uncertainty is a common experience in times of change and transition.

12. I used a traffic app to find the fastest route and avoid congestion.

13. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

14. Dime con quién andas y te diré quién eres.

15. Los blogs y los vlogs son una forma popular de compartir información en línea.

16. Masarap ang pagkain sa restawran.

17. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

18. Pakitimpla mo ng kape ang bisita.

19. Sino ang doktor ni Tita Beth?

20. I don't think we've met before. May I know your name?

21. Nagwelga sina Ka Leo laban sa pamahalaan.

22. If you spill the beans, I promise I won't be mad.

23. May gusto ka bang gawin mamayang gabi?

24. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

25. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

26. Marahan niyang inalis sa pagkakakawit ang mga balde.

27. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

28. Anong oras natutulog si Katie?

29. Sapatos ang gustong sukatin ni Elena.

30. She was feeling tired, and therefore decided to go to bed early.

31. Therefore, we should all steer clear of this bad habit of smoking cigarettes

32. Maaf, saya tidak bisa datang. - Sorry, I can't come.

33. Nació en Caprese, Italia, en 1475.

34. Ano pa ho ang pinagkakaabalahan ninyo?

35. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

36. Les programmes d'études sont élaborés pour fournir une éducation complète.

37. Los héroes son ejemplos de liderazgo y generosidad.

38. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

39. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

40. Pero sa isang kondisyon, kailangang bayaran mo.

41. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

42. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

43. Hindi pa ako nakakapunta sa Barcelona.

44. Kahit bata pa man.

45. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

46. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

47. Patawarin niyo po ako, nagpadala ako sa mga pagsubok.

48. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

49. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

50. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

Recent Searches

kutodcareerayokobumabahaconsumedikyamhigh-definitionincidenceisdacapitalkatandaannakapuntainterestskagandahaynakaimbakorugapostcardpaskobuwannumerosasinasahigrestawansparkfraipagbilileyteabonofigureipantalopoutsciencenaritoumiinitkitangoutlinesreportpapuntaroleeveningplaysangneromagtatanimpadabogandamingmotionaggressionmagbubungaeveryanimdingginnasundobwahahahahahasizeprogramsprogramminglibrocuandocirclecontrollednagsimulainstrumentalmagsasalitabaliwnakapamintanapasyentedinpassionactivitynagsisigawnagbigayanswimminganjophilippinepagiisipbunutankakaibangmagkasinggandalaamangnasanmelissahumblegamotsupremekaliwasitawjennyorderlabananauthoribababulsasedentarynogensindebatayindustriyaenfermedades,kitang-kitasarongnabigaybayanipakilagaytanghalihinalungkatrabbadespuesnapapatinginsandalingtagaktayomagpapabakunaniliniscryptocurrency:busyangdawlayaspartysetyembrepasensyamatabangsusikatagalanstaynamuhaymangyarinakatuonmanghikayatprotestaberegningerstrategynangangahoytuluyannasabinghaliplabinsiyamtrainskontinentengfotosginangpeternanakawanfullmakikiraannakatayolumalakikilalamakikipaglaropamburaiiwasanlikodvigtigstenagpipiknikitinaliminu-minutoumiinomshiftgivermahiwagangikinamataymakatarungangkamaoerlindamininimizemaynilaatpinamalagikasintahanmaghahatidtelevisedpalantandaandisfrutarsobrakumirotnakakapamasyalwriting,remainngisisukatdecreasedhigantemalilimutanbiologimalayanagsunuranregaloomfattendeobtenertindalumitawuulamintatlongpromotingvisualduranteprimerasmukhangparusaosakatumawag