Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "career"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

4. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

5. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

6. In addition to his musical career, Presley also had a successful acting career

7. Limitations can impact one's career, relationships, and overall quality of life.

8. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

9. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

10. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

11. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

12. The uncertainty of the job market has led to many people rethinking their career paths.

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. Sorry hindi kita nasundo. apologetic na sabi si Maico.

3. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

4. Nakagagamot ng diyabetis ang halamang ito.

5. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

6. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

7. The uncertainty of the situation has made it difficult to make decisions.

8. If you want to get the best deals at the farmer's market, you have to be the early bird.

9. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

10. Hindi masikmura ni Manuel na ang binibigay na pera ng ilang pulitiko ay galing sa kasamaan.

11. Overall, television has had a significant impact on society

12. Ailments are physical or mental health conditions that cause discomfort or illness.

13. Sa Taal, Batangas matatagpuan ang Mabini Ancestral House na pinaniniwalaang bahay-bata ni Apolinario Mabini.

14. Nous allons faire une promenade dans le parc cet après-midi.

15. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

16. Mabait sina Lito at kapatid niya.

17. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

18. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

19. Emphasis can be used to create rhythm and cadence in language.

20. Members of the US

21. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

22. Siya ay nagiigib ng tubig sa banyo habang nag-aayos para sa trabaho.

23. Nagitla siya nang bago pa makalapit ay nagpalit anyo ito.

24. Nanatili siya sa pagkakatayo nang ilang saglit, wari'y tinakasan ng lakas, nag-iisip ng mga nakaraang pangyayari.

25. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

26. La novela produjo una gran empatía en el lector hacia los personajes.

27. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

28. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

29. The artist painted a series of landscapes inspired by her travels.

30. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

31. ¿Dónde está el baño?

32. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

33. Alles hat ein Ende, nur die Wurst hat zwei.

34. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

35. Está claro que necesitamos más tiempo para completar el proyecto.

36. Frohe Weihnachten! - Merry Christmas!

37. Ano ang ginawa ni Tess noong Marso?

38. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

39. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

40. Limitations can be overcome through perseverance, determination, and resourcefulness.

41. Hindi pa rin siya umaalis sa kinauupuang balde.

42. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

43. Their primary responsibility is to voice the opinions and needs of their constituents.

44. Sa pagguhit, hindi kailangan na perpekto ang mga linya at kulay mo.

45. Inakalang nanalo siya sa laro, pero may mas mataas pa palang puntos ang kalaban.

46. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

47. There?s a world out there that we should see

48. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

49. Dalawa ang pinsan kong babae.

50. Naglalaro siya ng video game nang biglang nabigla sa biglang pag-apoy ng computer.

Recent Searches

careernaglalambingwidespreadbinigyanggreatlygranmasasalubongconectadoszoommakapaniwalacommunityahitmakapagpigilandaminglordwordduonmakapagbigayelvismakakatulongprincemaintindihanmagsusunuranmagsi-skiingnagreplymagpasalamatmagpapapagodmagpapagupitmagkakapatidpaksaulitsalitangsmokingpagkakatayokinatatayuanmunaipinagbabawalnatalongmatandang-matandakinasuklamanikinabubuhayfreelancing:far-reachingenfermedadesbarungbarongautomatisereanak-mahirapadditionallyadaptabilityunti-untingunibersidadtumatanglawtuluy-tuloytuloy-tuloytaga-tungawpaghalakhakreservationreserbasyonpumapaligidprogrammingprincipalespinapatapospinakawalanpinagsasabipinagmasdanasawamaawaingpinagkiskiseconomicopportunitypinaghihiwaipagtanggolpinagbigyanreachpaulit-ulitparurusahanpangungusapmasasayapamamahingajeetpamamagitanpaki-chargepagtatanongpagpapatubopagkakalutorinpapalapitlumuhodtmicaledpakakatandaanmachineskuyanagwelgamanamis-namisprinsipekinauupuannagsagawanagpabayadnanghihinamadsinongeskuwelakarwahengpanahontatawagipinikithubad-barousanagtatanongeskwelahant-shirttumawagtinatawagfigureskubyertosbyggetpangyayaridesisyonannalugmokmakatatlotindanagmistulangsasagutinfeltkumaliwanangangakoinuulcerphilosophicalpaghaliknasaanjuegosunidosfactoresmagawamaongelenailagaylistahaninimbitanatulogatentosakopmanlalakbaysumasakayhumpaytibigmissionbarangaylayuninipipilitbinibilangaddressspeechpinunitsurgeryisasamaprivatenunotransmitspancitshockbingoflaviopumatolunomacadamiaencounterhomeworkwalletleopalengkebutascurrentgitnaprogresstypesgaprememberallowedlawaamountmaratingfourextrabeforeestablishedhimselfechavejunioipapahingainternetcestelevisedkasinggandacomunesnangyaringnagtataasearnumingitnoble