Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "communicate"

1. Ant-Man can shrink in size and communicate with ants using his helmet.

2. Aquaman has superhuman strength and the ability to communicate with marine life.

3. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

4. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

5. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

6. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

7. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

8. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

9. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

10. The invention of the telephone and the internet has revolutionized the way people communicate with each other

11. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

12. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

13. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

Random Sentences

1.

2. ¿Dónde está el baño?

3. The United States has a system of federalism, where power is divided between the national government and the individual states

4. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

5. Ang kanilang anak ay tinawag nilang Amba.

6. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

7. Mula noon ay laging magkasama ang dalawa.

8. Puwede ho ba akong kumain ng baka at baboy?

9. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

10. Samantalang si Perla naman ay masipag at masinop sa kabuhayan.

11. Bawat pamilya ay may magarang tarangkahan sa kanilang mga tahanan.

12. Dahil sa sarap ng lasa, nahuhumaling ako sa pagkain ng mga matatamis na pagkain.

13. Nasa kanan ng bangko ang restawran.

14. The police were trying to determine the culprit behind the burglary.

15. Siguro nga isa lang akong rebound.

16. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

17. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

18. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

19. Some people argue that it's better not to know about certain things, since ignorance is bliss.

20. I don't want to beat around the bush. I need to know the truth.

21. Paborito nyang panoorin ang Baby shark sa youtube.

22. Isang araw, ang katulong ng bagong Sultan ay humahangos at ibinalitang may isang punongkahoy na tumubo sa kinalilibingan ni Sultan Barabas.

23. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

24. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

25. Naging tradisyon sa aming barangay ang nagiigib ng tubig para sa binyag ng mga sanggol.

26. Cutting corners might save time now, but it will cause problems down the line.

27. Ayon sa doktrina ng Simbahang Katoliko, ang purgatoryo ay isang lugar kung saan ang mga kaluluwa ay nag-aayos bago pumasok sa langit.

28. Sapagkat baon sa hirap ang lahat, napipilitan silang maging sunud-sunuran sa napakatakaw na mangangalakal.

29. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

30. Beber suficiente agua es esencial para una alimentación saludable.

31. Hoy en día, el internet es una parte integral de la vida cotidiana.

32. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

33. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

34. She has been baking cookies all day.

35. The pursuit of money can have both positive and negative effects on people's lives and relationships.

36. Sweetness is an important factor in the culinary arts and food industry.

37. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

38. Il est important d'avoir une compréhension des probabilités et des cotes lorsque l'on joue.

39. Working in a supportive and positive environment can improve job satisfaction.

40. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

41. Natutuhan ng mga mag-aaral ang talambuhay ni Heneral Luna at ang kanyang ambisyon para sa pagbabago ng bayan.

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43.

44. Hinanap niya si Pinang.

45. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

46. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

47. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

48. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

49. Nakahug lang siya sa akin, I can feel him..

50. Ang pagtulog ay isang likas na gawain na kinakailangan ng bawat tao para sa kanilang kalusugan.

Recent Searches

magigitingjosephpinalutoshiftcommunicatealloweditinalisofasizeoperatetargetmininimizekumirotnotebooknanaogmulingsettinggenerategitaraatensyongdinaladividestechnologyipapaputolmakasarilinglefttechnologicalmang-aawitpaslitpalamaestroguitarranakadapatayoteachingsinlovesaymagagawasystemharapanmag-aarallalawiganvalleylimitpaki-drawingkingdommaliitryanaabotbanggainmarahilpumasoknagmungkahimedya-agwabaultekalordlalongsundalogjortsagasaanpagsambamalagoiilanwastenabigkas1954pinagkasundonaglaroayawkapainmalihisampliagoshkasamamagkasamahumanapresultamuligtkanilakanayangtinapayentrecommissionipinauutangplacekaninumanculturaoktubrecarsweddingloanskikitafactorespinakamatapatbevarehanapinboknakapagreklamoninafarmnakaluhodnobleturismobuhokwaterkamalayankuninpahabolselebrasyonbumalikbenefitskatagalannangagsipagkantahansumasakitlayasunibersidadgumisingmagalangmabaitmapagbigayjackyginaganoonpagbisitapinagsasabisang-ayonwaiterpalabuy-laboyfeelpiyanopagpapatubocosechar,nakahugpawiingreatmarangalourpinakamalapitbagyohapag-kainantindapaumanhinhydelnatandaanpagpiliglobalisasyoncalidadnaguguluhangnilalangnakaangatnapabayaan1876meanmagkabilangotrorecibirsigemaibigayaltcantidadibinubulongnaliligoninongnabiawangikukumparamensajessakintiyakannapadaanhimselfmagbabagsikibinilibisigidiomabinigayhatinggabisuelopinaulanannakatulogperfectlalakeiigibmaawaingteleviewinglargerpakisabinapadpaddoonnagpabotmakauwialaybababopolstagakanimoypagbebentaitinaassarilikutsilyoherramienta