Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "communicate"

1. Ant-Man can shrink in size and communicate with ants using his helmet.

2. Aquaman has superhuman strength and the ability to communicate with marine life.

3. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

4. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

5. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

6. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

7. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

8. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

9. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

10. The invention of the telephone and the internet has revolutionized the way people communicate with each other

11. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

12. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

13. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

Random Sentences

1. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

2. Work can also provide opportunities for personal and professional growth.

3. Pero gusto ko nang umuwi at magpahinga.

4. Kanino mo pinaluto ang adobo?

5. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

6. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

7. "A dog is the only thing that can mend a crack in your broken heart."

8. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

9. Magkano ho ang arkila ng bisikleta?

10. Daraan pa nga pala siya kay Taba.

11. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

12. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

13. He forgot his wallet at home and therefore couldn't buy lunch.

14. Gunung Bromo di Jawa Timur adalah tempat wisata populer untuk melihat matahari terbit di atas gunung berapi yang aktif.

15. We've been managing our expenses better, and so far so good.

16. Aerob træning, såsom løb og cykling, kan forbedre kredsløbets sundhed og øge udholdenheden.

17. Babayaran kita sa susunod na linggo.

18. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

19. If you quit your job in anger, you might burn bridges with your employer and coworkers.

20. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

21. He admires the athleticism of professional athletes.

22. There were a lot of toys scattered around the room.

23. Gusto mo bang sumama.

24. We have completed the project on time.

25. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

26. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

27. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

28. Magandang umaga po, mga mahal na manonood.

29. The first dance between the bride and groom is a traditional part of the wedding reception.

30. The surface of the football field can vary, but it is typically made of grass or artificial turf.

31. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

32. Paano mo nalaman? tanong ko sa kanya.

33. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

34. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. Napabayaan na nga ang diyosa ng mga tao at hindi na nag-aalay ng bulaklak sa kaniya.

37. Ikinagagalak kong makilala ka, Maria.

38. Napuyat na ako kakaantay sa yo.

39. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

40. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

41. Lalong pinagsikapan ng paring Kastila ang pagtuturo ng buhay at mga aral ni HesuKristo.

42. Yari sa kahoy ang sahig ng bahay ko.

43. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

44. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

45. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

46. Limitations are the boundaries or constraints that restrict what one can or cannot do.

47. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

48. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

49. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

50. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

Recent Searches

simplengcommunicateniceblessdosspeechsteerpeterdarktrainingartificialmatangkadnaalisjunenoodmedyomaasimlagirecentpaulit-ulitbuwismagingpaskomaramotmagdamagankalakihanlumiwagbungangmalalimngunitdoble-karanatinagumikotsakalingvirksomhederkassingulangkindergartenisinamainsidenteinuminfollowedbinawianpalakatoothbrushcompanyibinalitangpundidonakagawianmassesmalumbaysiembrayesbasahinpagdiriwangressourcernecoaching:spiritualpagpapakalatnagkitamagkakaanakkumembut-kembotpagsalakaynapatawagnakatuwaangtinaasannanghihinamagkakailanagtatamponangangahoypare-parehoikinasasabiknagpapaigibkumikilostatayokinakabahanyumabongnagkasunogpaglalaitdadalawinpagkapasokmaliksinalalabilumitawdahilnaglalaroinatakebuwangurotaga-lupangmabilispalagipandemyajeepneyideologieshabitsinusuklalyanumiimikpangungusapmakabawimangahasmakikitulognapasubsobsharmainekatuwaanmananakawleaderslarawanmag-alaspagkatotsospillpasukansakitorderkakilalaenglishtig-bebeintetinatanongtumamisibinaonpaciencianakahainjejuumigtadpeksmannataloniyoitinaobhinatidiikotnaawalibertymagpakaramitanghaligagamitsamantalangnakariniginfusionesmagdaanopportunitymagsimulakubonatayopangalananlumbaymukhahumigasahodnangingitngitathenapangilituturokargangelenapaldatigasnaturalthroatkenjiricobutimagdalatshirtfauxpalaywalongmaskiautomationmagbigayanbilibstruggledmagisingsetyembremaingatattentioncalciumsiemprecanadapisoarbejderneagrammarskypegraphicdipangtsehamakyelofreelancerdemocraticbriefharingcommissionsystematiskmayokadaratingmanuscriptgamotkalabawpinangyarihan