Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "vegas"

1. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

Random Sentences

1. Prost! - Cheers!

2. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

3. Anong buwan ang Chinese New Year?

4. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

5. The level of sweetness can vary in different types of sugar and sweeteners.

6. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

7. Honesty is the best policy.

8. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

9. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

10. Kung ako si Maico? Malamang magwawala ako. aniya.

11. He cooks dinner for his family.

12. I've been driving on this road for an hour, and so far so good.

13. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

14. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

15. Madalas itong nag ku-kwenta ng kanyang mga kinikita.

16. If you keep cutting corners, the quality of your work will suffer.

17. Pabili ho ng isang kilong baboy.

18. Goodevening sir, may I take your order now?

19. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

20. Sino-sino ang mga inimbita ninyo para manood?

21. Yari sa kahoy ang sahig ng bahay ko.

22. Kapitbahay ni Armael si Juang malilimutin.

23. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

24. Ngunit ang bata ay mahinahong sumagot.

25. Ikaw ang magnanakaw! Amin yan! Nasa ref ng bahay ko!

26. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

27. Hindi siya makatulog dahil sa kati ng bungang-araw.

28. Ok. Alam mo, isa pa yung excited na magka-apo eh.

29. Marami sa mga bayani ay nakatanggap ng pagkilala at parangal dahil sa kanilang mga naging ambag sa bayan.

30. Bumilis bigla yung tibok ng puso ko.

31. All these years, I have been grateful for the opportunities that have come my way.

32. Det er vigtigt at kende sine grænser og søge hjælp, hvis man oplever problemer med gambling.

33. Nagpamasahe siya sa Island Spa.

34. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

35. Ok. Free ka ba after work? Favor lang sana please.

36. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

37. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

38. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

39. Les employeurs recherchent des travailleurs fiables et ponctuels.

40. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

41. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

42. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

43. Lazada is an e-commerce platform that operates in Southeast Asia.

44. Limitations can be overcome through perseverance, determination, and resourcefulness.

45. Anong nakakatawa? sabay naming tinanong ni Sara

46. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

47. Football coaches develop game plans and strategies to help their team succeed.

48. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

49. El mal comportamiento en clase está llamando la atención del profesor.

50. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

Recent Searches

binawianandreaipinambilivegasunconventionalpagmamanehowhethergustongnapakamalawakvariedadmalasutlabunutanmaghintayganitoanilasikipnapapikitpondotokyonamaasiaticalasdumilimnagisingpangiltumutubomagisinginterestskasakithomebilihumbleinulitadvancehusosentenceisangsoccersamakatwidmalapadbilaoluluwasjuliusipinabalikfriday1973ipanliniswellbinabaantandabaohardtargetbakitnotebookpaatogethertransitbringtopicnapatataasdalawinmauntogbopolssumasakaysisentasongsbarongkumaendiliginitinaasnabiglatusonglumbaylilipadbanalpakilagaynatalopunong-kahoyfurychavitpitakafakematchingtryghedsystematisksumabognilinisshortmayonagbungasellkabibisinipangdawspeechesmesangmagpuntamawalapaki-translateisinulathila-agawankagandahagpamburabangladeshnagliliyabnakakadalawvirksomheder,kinatatalungkuangnalulungkothiwatumagalpagtangiskalaunanmorningnaulinigannabubuhaytaun-taonnamulaklakmamanhikannanahimikerlindamaliksipagkapasokhumahangospagsumamonapaluhamarurumitumiradisfrutarkalakipaglalabakumakainbigyanngumiwiawtoritadongtinakasankasintahanmagpalagoleadersuugod-ugodnaliwanaganmaipagmamalakingdaramdaminmasaksihannangahasnaiilaganaboberegningernagtataepoonglumabasusuariomagtagopagkagisingjejupagkaawatahimiknagdabogilalagayyumabangmagsugalbwahahahahahaprodujonapasubsobintindihinsabihinsakyannapawilolaparusahanrespektivepaalamtelebisyontrentaisinusuotmahabolkastilangnagtaposmagisipnawalataxikagubatanhiganteika-12automatiskkontingcapacidadisamastocksnasaninalagaanskyldespaanoambagnaismanilabinibilang