Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "reach"

1. All these years, I have been overcoming challenges and obstacles to reach my goals.

2. Dedicated teachers inspire and empower their students to reach their full potential.

3. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

4. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

7. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

8. Scissors should be handled with care to avoid injuries and kept out of reach of children.

9. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

10. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

11. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

12. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Pumunta kami kahapon sa department store.

2. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

3. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

4. Ang mailap na kahulugan ng salita ay kailangan unawain nang mabuti.

5. Bakit ka nasa hospital?! Sorry kanina.

6. Time heals all wounds.

7. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

8. Después de hacer ejercicio, me gusta darme una ducha caliente.

9. Gusto ko na talaga mamasyal sa Singapore.

10. It's frustrating when people beat around the bush because it wastes time and creates confusion.

11. La pobreza es un problema que afecta a millones de personas en todo el mundo.

12. Sa facebook kami nagkakilala.

13. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

14. I know I should have gone to the dentist sooner, but better late than never.

15. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

16. It's nothing. And you are? baling niya saken.

17. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

18. Ahh... haha. Umiling na lang ako bilang sagot.

19. Ang tunay na pag-ibig sa bayan, ay sa sariling wika nagsisimula.

20. Naka color green ako na damit tapos naka shades.

21. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

22. Ang mga pangarap ay nakakapagbigay sa atin ng determinasyon at inspirasyon upang magpatuloy.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Nagsisilbi siya bilang volunteer upang magbigay ng tulong sa mga nangangailangan.

25. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

26. Claro que puedo acompañarte al concierto, me encantaría.

27. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

28. That'll be 4,788.50 pesos ma'am.

29. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

30. He admires his friend's musical talent and creativity.

31. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

32. Gaano katagal ho kung sasakay ako ng dyipni?

33.

34. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

35. Sino ba talaga ang tatay mo?

36. Nagpapasalamat ako sa aking mga magulang dahil sa kanilang bukas palad na pagtanggap sa akin kahit anong desisyon ko sa buhay.

37. Sapagkat misyunero, marami ang naliwanagan sa katotohanan.

38. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

39. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

40. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

41. Ang nagtutulungan, nagtatagumpay.

42. Sinabi niya sa dakong huli na gusto na niyang mag-resign sa trabaho niya.

43. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

44. Ano ang gustong bilhin ni Juan?

45. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

46. He is not watching a movie tonight.

47. Bakit umiiling ka na naman? May problema ka ba?

48. Ikaw ang dumukot ng pitaka ko, ano? Huwag kang magkakaila!

49. Puwede ba kitang yakapin?

50. Limitations can be a result of geographic location or access to resources and opportunities.

Similar Words

far-reachingreaching

Recent Searches

reachmadurasniyanboylumiitlazadanatuyobalatguardamagturoverymasayahindomingoejecutankaaya-ayangnataposcallerwordspananglawtapatmakatiyakaga-agaasokapataganpeppygubatnatatawasagingsikowashingtonandrespagtutolginamitpagkaimpaktototoosantosinfluencepauwieverybinilhanadecuadoupangyouthinggagwalaunconstitutionalsoundkabuhayanspaghettiparemakatilimospagtatanimmagpapakabaitprosesopagtangisbolapapagalitaneffectseksaytedmahinogstagestringrawlaruinmariloucourtpagkabiglabrancher,taga-nayononcegumalanakakatawatulangnuonmbalopollutionkailanmobilebisigcantidadmay-bahaypapanhikfly1954kangkongissuesmahiwagahadlangmakakakainmahigpithayaanghigamagkasabaypangniyatinapaysusunodyataguerrerosagotfuelbayaningchoiparusahanexpeditedmatikmancrazyeclipxeenergypagtinginpamilyaibinubulongmapapaengkantadangh-hoynakayukopatipeksmanpagkabuhaybinibilibawianmakapangyarihannangahasyungmababasag-ulopinakingganminahankakapanoodnagdalaproblemamemorektangguloprocessformdespuespopularizemaitimsamaworkdaynakapagproposeprogramabeermatigaskumananikinuwentomabigyanafternoontelecomunicacionesmariebisitaressourcernebangmumuraginawapasalubongmisteryosongkabuntisantalagangsalbahengpsssnakagawianpatutunguhandumagundongnalalamandilawpilipinasmiranahigitanmauliniganiguhitikinakagalitmulimoodnewmay-ariabotbranchespinangyarihanpagsidlangooglemulti-billionpakakatandaanbeintesigloproporcionartilltayongmagsusuotgagamitnagpasansquattersinagotpositibotumayonatingalacualquierunosdasal