Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "range"

1. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

2. Ailments can range from minor issues like a headache to serious conditions like cancer.

3. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

4. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

5. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

6. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

7. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

8. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

9. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

10. The bookshelf was filled with hefty tomes on a wide range of subjects.

11. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

12. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

13. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

14. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

Random Sentences

1. Isang babae na mahaba ang buhok na kulot, nakablue gown sya.

2. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

3. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

4. Ano ang ginawa niya pagkatapos ng giyera?

5. Mas maganda kung tayo ay maging totoo sa ating sarili kaysa sa magpakatanga sa kababawan ng mundo.

6. The pretty lady in the movie stole the protagonist's heart.

7. Nandiyan po ba si Ginang de la Cruz?

8. Hindi siya puwedeng uminom ng beer.

9. Paparami iyon at pumapaligid sa kanya.

10. Kapag nagtutulungan, nagtatagumpay.

11. Ang magnanakaw ay kumaripas ng takbo nang mabisto ng tindera.

12. Bagai pungguk merindukan bulan.

13. Ihamabing o kaya ihalintulad ang isang bagay sa ibang bagay

14. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

15. Helte findes i alle samfund.

16. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

17. Ang daming tao sa divisoria!

18. Sa pamamagitan ng kalayaan, malaya tayong magpahayag ng ating mga opinyon at paniniwala.

19. Dumilat siya saka tumingin saken.

20. Tuwang tuwa ang mga tao dahil magaganda ang kanilang ani.

21. It's complicated. sagot niya.

22. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

23. Ayaw mo ba? tanong niya sa malungkot na tono.

24. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

25. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

26. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

27. Helte kan have en positiv indflydelse på hele samfundet.

28. Reden ist Silber, Schweigen ist Gold.

29. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

30. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

31. May mga nagpapaputok pa rin ng mga paputok sa hatinggabi kahit bawal na ito.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Sino ang binilhan mo ng kurbata?

34. Diving into unknown waters is a risky activity that should be avoided.

35. Ang mga bayani ay nagpapakita ng malasakit at pagmamalasakit sa kapwa tao.

36. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

37. Magbibiyahe ako sa Mindanao sa isang taon.

38. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

39. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

40. En tung samvittighed kan være en kilde til stor stress og angst.

41. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

42. Ang laki ng sawa na kanyang nakita.

43. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

44. Laganap ang fake news sa internet.

45. The event was sold out, and therefore we couldn't get tickets.

46. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

47. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

48. Arbejdsgivere søger pålidelige og punktlige medarbejdere.

49. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

50. Nakakain ka ba ng mga pagkaing Pilipino?

Recent Searches

binasatopicrangekasalukuyanmagpa-checkupikinabubuhayunibersidadnakaluhodpaki-translatepagpapakilalaellendumagundonggagawinbibisitaartistasnakalagayglobalisasyonpapagalitankatawangcultivarmerlindalumalakitanggalinginugunitakabundukankabuntisanpaanongnagkalapitkapasyahanmahahaliknahintakutansakristanmahahanayinilalabasinakalangtabingpartsmarurumimakabawimaintindihanbyggetkolehiyolondonnaglaromalapalasyonaapektuhanmagsasakatagalogpahabolkumanannamuhaynaaksidentenagbabalanasagutanmahuhulinagsamasiguradokumirotkatutubopatakbopamilyavegasmarinigahhhhkainandesign,nagniningningbinabaratkaninaunosmahigittanyagtakotconclusion,telecomunicacionesbihirangsukatintandangsumalakaygagamitsteamshipspagiisipkesokampanapropesorkunwasandalingfederalbalinganmanilaatensyonbuwayasisipainmerchandisemabutimisteryogulangpayapangmagsabifrescoiyanbandamatamanmalapitanmayamangpublicationibinentapuwedetasahinabolupuansontransmitidassnabiluganggivekaboseseffektivalamidgodtchoihmmmpatisigasamfundmulighedreservesbagyotonightlossrosasenateramdambukodpeaceguhitnakahainbabaealingotrasfertilizerjackztryghedgabechoiceuncheckedcalleripagbilileytelangactingcommunicationshowcoachingngpuntailandinadventformascuentanpulapagkakakawitprogrammingdevelopentrysalapijunjunworkshoppatrickandroidformstechnologicaldulowindowsahodthinkbirthdaykitsamadeclarebasaenforcingdecisionstalenasundoaidmaputibilhinratehelpfullikodforstånakatawagbumotomamipakikipagbabagnagtatanghalianpinag-aaralannapasobratherefore