Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "range"

1. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

2. Ailments can range from minor issues like a headache to serious conditions like cancer.

3. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

4. Ariana Grande is an American singer, songwriter, and actress known for her wide vocal range and powerful voice.

5. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

6. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

7. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

8. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

9. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

10. The bookshelf was filled with hefty tomes on a wide range of subjects.

11. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

12. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

13. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

14. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

Random Sentences

1. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

2. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

3. Les élèves doivent travailler dur pour obtenir de bonnes notes.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. Protecting the environment can also improve public health by reducing exposure to harmful pollutants and chemicals.

6. Kontrata? halos pasigaw kong tanong.

7. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

8. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

9. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

10. Mababa ang tingin niya sa sarili kahit marami siyang kakayahan.

11. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

12. Television has also had a profound impact on advertising

13. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

14. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

15. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

16. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

17. Ang malawak na kagubatan ay isang magandang halimbawa ng isang ekosistema na mayabong.

18. Sinampal ko ng mahina yung pisngi ko.

19. Wag mong ibaba ang iyong facemask.

20. Masdan mo ang aking mata.

21. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

22. Después de leer el libro, escribí una reseña en línea.

23. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

24. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

25. If you're trying to get me to change my mind, you're barking up the wrong tree.

26. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

27. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

28. Nag shopping kahapon si Tita sa SM.

29. Sa bahay ni Pina ang salu-salo.

30. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

31. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

32. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

33. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

34. Ang pagtulog ay mahalaga para sa kalusugan at kagalingan ng isang tao.

35. The teacher explains the lesson clearly.

36. Ang taong mapagbigay, sa kapwa ay may kapatid.

37. High blood pressure can be managed effectively with proper medical care and self-care measures.

38. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

39. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

40. Maagapan natin ang walang humpay na paghaba ng kaniyang buhok, subalit hindi na natin maibabalik ang normal na kapal nito.

41. Ariana is an advocate for animal rights and follows a vegan lifestyle.

42. Malapit na naman ang pasko.

43. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

44.

45. Before television, most advertising was done through print media, such as newspapers and magazines

46. The restaurant was full, and therefore we had to wait for a table.

47. Sang-ayon ako sa panukalang ito dahil makakatulong ito sa mga nangangailangan.

48. Tumagal ng ilang minuto bago natapos ang palabas.

49. Masarap makipagkaibigan sa taong bukas palad dahil alam mong pwede kang umasa sa kanya.

50. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

Recent Searches

lasingerorangeimportantesshockislamasaksihangumagamithanapinkusinanapanoodumuponatinagikinatatakotnaibibigaymag-inakinikitaeksempeljingjingkanginamagdamaganprobinsyavariedadboyfriendbinawianalassoccerphilippinekatedralmaliitthanktengakarangalanmananahipulisabispeechescollectionsburdennyamariegandatoretesoonso-calledpaslitmagkakailacomepinagawachesspagdudugoalamnananalongmalapalasyocorrectingpioneersharefuturetitaexpectationsquicklyvasquesnalugmokipinalutoatensyongsummitmagkaibangmagpakasaltinawagtotoongtumirahayaangnecesarioseguridadpagkakalutonagpapakainmakukulaymanlalakbaypandidirivedvarendecombatirlas,maibigaysiyangculturesnakangisingsakenkulturcantidadhagdanannaghubadkaliwabighanipinangalananbefolkningenpagbigyannaghihirapnaramdamanmahuhulisimonbinitiwanmagpa-pictureenhederkinumutanvaccinessusunodcriticsilonghistoryreservationtablehabitsnuevoslever,babykonsyertofionaipinasyangaguamaghatinggabiboholtagakkumaensarongkumustabihasapalapagrevolutionizedbiyerneskakayanangsetyembrelayuanmrsmalumbayisinalangchildrenmagkasinggandabumabaggraphicnahigascottishanihinparihinigitnogensindekagandakasaysayanbasahinincidenceanito1954apoysecarseclientesviewsspeechblazingxiximagingcomunesbulsacryptocurrency:promotingballdinalawnalasing1980landasmarsogelaiikinalulungkotgamemaramiinalokmajorkalikasangalitanimoguiltyinfluenceprovidedactionprogramacomputerestartedbabesolidifygitanashateaffectlutuininformedgalinghighesticonsactorinaapiheftymanamis-namisnagkakatipun-tiponmakalaglag-pantydiwatang