Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kasingtigas"

1. Kasingtigas ng loob ni Sultan Barabas.

Random Sentences

1. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

2. Sa halip na umalis ay lalong lumapit ang bata.

3. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

4. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

5. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

6. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

7. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

8. Nasa harap ako ng istasyon ng tren.

9. Ang mabuting kaibigan, ay higit pa sa kayamanan.

10. Habang wala pang trabaho ay matuto kang magtiis na asin ang ulam.

11. Kinuha ko yung CP niya sa bedside table.

12. May naisip lang kasi ako. sabi niya.

13. Cada nacimiento es un milagro y un regalo especial.

14. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

15. Nous avons réservé une salle de réception pour la célébration.

16. Gaano kadalas kang nag-eehersisyo?

17. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

18. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

19. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

20. Madalas ka bang uminom ng alak?

21. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

22. Einstein was a pacifist and spoke out against war and violence throughout his life.

23. Libre ba si Carol sa Martes ng gabi?

24. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

25. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

26. Kebahagiaan sering kali tercipta ketika kita hidup sesuai dengan nilai-nilai dan prinsip hidup yang penting bagi kita.

27. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

28. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

29. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

30. Has she met the new manager?

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

33. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

34. Magkano ang polo na binili ni Andy?

35. Gawa ang palda sa bansang Hapon.

36. Está claro que hay diferencias de opinión en este asunto.

37. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

38. Pumunta ang pamilyang Garcia sa Pilipinas.

39. Ikinasasabik ni Armael ang pagpunta sa kasal.

40. Que la pases muy bien

41. Ang mga buto ng mais ay dapat na itinanim sa loob ng 1-2 pulgada sa lupa, at dapat na itinanim sa isang distansya ng mga 8-12 pulgada sa pagitan ng bawat halaman

42. Sino ang bumisita kay Maria?

43. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

44. Palaging sumunod sa mga alituntunin.

45. Naaksidente si Juan sa Katipunan

46. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

47. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

48. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

49. Kapag nakuha na niya ang aking puso saka lamang siya magkakaroon ng kapangyarihan sa mga nilalang dito.

50. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

Recent Searches

kasingtigasBaryokamaTradisyonkasivedbarangayngunitKumbinsihinedukasyonmariarightsiniyasatseekanakgusgusingtayopapellabangitaralaronggalitlegislationvehiclessetsebidensyacrushpatpatorkidyassubalitsinumanyatakungpagdiriwangmagpahingasalamatna-fundbagkusbayaniaraw-makauwininamalalimpabulongtotoopasaherokayapopulationpagkatakothamonriyannasagutansapagkatpangungutyanasannapakamotsilid-aralankaykasiyahanpaksaikinagagalakganyanhinditandanggumalamaaringtilahimutokkindskahitbasahinkamalayanlaptopgreenhillsbukasgaanokwartodahillihimkanyangkasalananumupopagtatakapaaralanbaketmestbataykinagalitannenadollaradobosalatpunodaddyperopigingpokertomsystemofrecendawhabanggurodilagyelomaduraslunesmanuksodatugalaankalyetuladsumayawnamatayhunipaskosilaysantopilipinopalipat-lipatairportmag-galabaroburolpasswordinakalaawitkarununganusaeroplanoganidbihasakatotohanannaghuhukaynagcurvesamantalangpulisemocionescafeterialumipadiwinasiwaskaragatan,matanggapnagbabasatabaslabasmabilistinitindakomunidadcampkasopakanta-kantangrefgawanmarahassinomarahiltumulongicebulongsino-sinoalanganbalitadelcuentakaninhanggangugalikamisetabakaagam-agampanlolokoiligtassumakaypootniyanhinukaypinapakiramdamankumikinigkapit-bahayyongmay-bahaywifibilangleogutomkukuhahanginpananakopkaybilislalawigankutsilyoinspirepaglapastanganafternoonrolledkamaybinilingLunaskulisap