Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "propesor"

1. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

Random Sentences

1. Limitations can be self-imposed or imposed by others.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

4. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

5. Sapagkat baon sa hirap ang lahat, napipilitan silang maging sunud-sunuran sa napakatakaw na mangangalakal.

6. They are not shopping at the mall right now.

7. The grocery store offers a variety of fresh produce, including fruits and vegetables.

8. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

9. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

10. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

11. Kung hindi ngayon, kailan pa ang tamang panahon?

12. O-order na ako. sabi ko sa kanya.

13. A father's love and affection can have a significant impact on a child's emotional development and well-being.

14. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

15. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

16. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

17. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

18. The feeling of frustration can lead to stress and negative emotions.

19. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

20. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

21. Ang kumbento ang madalas tambayan ni Father at Sister.

22. Pinili kong mag-aral ng Edukasyon upang maging guro din sa hinaharap.

23. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

24. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

25. Ang aking teacher ay hindi muna nagturo ngayong araw.

26. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

27. The bakery specializes in creating custom-designed cakes for special occasions.

28. Palaging basahin ang alituntunin ng isang lugar.

29. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

30. Hindi pa ako naliligo.

31. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

32. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

33. Tila nagiging mas mahirap ang hamon habang tumatagal.

34. Forældre har ansvaret for at give deres børn en tryg og sund opvækst.

35. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

36. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

37. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

38. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

39. The dedication of parents is evident in the love and care they provide for their children.

40. Sobrang mahal ng cellphone ni Joseph.

41. Instagram has become a platform for influencers and content creators to share their work and build a following.

42. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

43. Ano ang malapit sa eskuwelahan?

44. Ano ang kulay ng mga prutas?

45. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

46. Sa gitna ng bukid, natatanaw ko ang mga kalabaw na umaararo sa lupang sakahan.

47. Puwede ba tayong magpa-picture na magkasama?

48. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

49. Ok ka na ba? tumango si Athena, Mabuti naman..

50. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

Recent Searches

naguusapanumangpropesorkapatawaranhinanakitpaligsahanvedvarendesinopatawarinnararapatgelaiisusuotkasamaangfederalismgabi-gabidraft,niyanhanginnaalispulitikodustpannilapitanbutitawatondotanganminamasdanmadalingalagabarangaypatonghinintaykakayanangsidobibilihinukaypangakoumibignovemberkapalbumagsaklagaslasisuboengkantadakatagangdyosabibigyansaronglugawresearch,tillhelenaipinansasahogherramientasanteskikotaasattractiveweretagalogboholareastignansupilinroselledisposalconsumeoutlineibinalitangmarmaingwateraksidentelipadgiverfe-facebookkulotbinibilangalasmariaskyldescolorfatheradditionally,alakstreetpa-dayagonalganitokasoyterminonamdollykunwaelenagisingmemocollectionsnatanggapumingitdalawbernardoseeprimersabihingritoasulbisiggrewsnobarghginangtaposaccederbuwanloansmabilispinyapitospentdoktorteleviewingadversesolaradangnagbasatransmitsbitiwaninfluencecigarettessinabicornersadverselydemocraticdatapwatriskdayslabingmaramisumakitjerrycafeteriababaebinabaliksusunduinbipolarayudabugtongdyanbillofficeuncheckedprobablementememorialunderholderbinigyangnyepagewordsrestawangabetanimtools,starpagbahingmatindingoliviaspecialsobrajacejackztrafficdagalaborsumusunomisusedleyteipagbilimisarelopakelamharingritwalnilinisspeechesmayoestablishimportantesjokebusyangkabibicongresspakainbalingdinalawboboisugaearnbriefinalokcommunicationsexpert