Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "squatter"

1. Madaming squatter sa maynila.

Random Sentences

1. Her charitable spirit was evident in the way she helped her neighbors during tough times.

2. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

3. TikTok has faced controversy over its data privacy policies and potential security risks.

4. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

5. Nanalo siya ng sampung libong piso.

6. Sa harap ng kahirapan, ang mga mahihirap ay nag-aapuhap ng tulong mula sa mga non-profit organizations.

7. I-google mo na lang ang mga tanong na hindi mo maintindihan.

8. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

9. Was du heute kannst besorgen, das verschiebe nicht auf morgen.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Nagbasa ako ng libro sa library.

12. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

13. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

14. Mas maliit ang bag ko sa bag ni Cassandra.

15. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

16. Money can take many forms, including cash, bank deposits, and digital currencies.

17. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

18. Matapos ang pangunahing pangyayari sa kabanata, nagkaroon ng bagong direksyon ang kuwento patungo sa susunod na yugto.

19. Air tenang menghanyutkan.

20. No te alejes de la realidad.

21. She has been cooking dinner for two hours.

22. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

23. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

24. Helte kan være en kilde til inspiration og motivation.

25. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

26. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

27. Magkahawak kamay silang namasyal sa gubat ng magagandang halaman na ang buwan at mga bituin ang tumatanglaw sa kanilang dinadaanan.

28. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

29. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

30. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

31. My coworkers threw me a surprise party and sang "happy birthday" to me.

32. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

33. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

34. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

35. Ahh.. sinuot na niya to tapos nag patuyo ng buhok.

36. Women have faced discrimination and barriers in many areas of life, including education and employment.

37. La paciencia nos da la fortaleza para seguir adelante.

38. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

39. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

40. I reached my credit limit on the card and couldn't make any more purchases.

41. Make a long story short

42. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

43. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

44. La comida mexicana suele ser muy picante.

45. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

46. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

47. Let the cat out of the bag

48. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

49. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

50. Las heridas que no sanan o empeoran con el tiempo pueden ser signo de una enfermedad subyacente y deben ser evaluadas por un médico.

Recent Searches

squattertabiwealthhawakanbalangnalamannakataasnanggagamottumigilmakapagpigilnalalagasinakalapagdudugomauliniganvanmasaganangcourtdahan-dahanplantasnakaimbakmakitangbuksanheartbeatkasamangentoncesgivergagandamuntikantilabobotomaawapromotepayathayaangcongratstwitchranayhundredsoundlimitedhoykabuhayankalabanpootbangkatabingreplacedmapaibabawinteligenteslearntelevisedcommercepointo-ordertawanansellingopportunitypaggawanangyarinag-iyakanmakapangyarihangnakakadalawmedya-agwabolanaglipanangsasayawinikinalulungkotmakakasahodcultivanaglalaroinjurynakalilipasmamanhikanbanyopagtangore-reviewcorporationmawalaibinibigaymahinoginspiredinaabotsalaminmasasabisapatoshawlakumantapalasyodecreasedipinambiligustongpaglayaskundimangayunpamansapagkatbinulongvisbosessagingtresmakilingindustryonceassociationgagokaydaysguestsanimomatindingunderholderkwelyonagtatampoevolvedexplaincertaincharitableeffectskamingkaaya-ayangkagandahanfilipinakwartomagbibiladkamandagstillprosesoiniindarespektivekauntiilanikinatuwadiseasede-latapublishedumikotformakassingulangkabilangbehindmaipantawid-gutomneedshopenagtitiisgongnagandahantotoonghinabolnagpadalapagpapakilalamalagobabasahinutak-biyaheartbinibiyayaanmasayangmakikiraanincreasinglynothingmissmatunawmauupotelecomunicacionespabalingattsongmaghahabivigtigstekingsumandalkabuntisanhaponninadagat-dagatankumananikinakatwiranalikabukineskwelahanevolucionadobusykulaysaymulingspeechtalepirataoverallfuepasensiyahelpfulplatformsshockiosngpuntarefersoutposticonpublicationkamustasakimothers