Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "way"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. All these years, I have been grateful for the opportunities that have come my way.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

5. By the way, when I say 'minsan' it means every minute.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Cooking at home with fresh ingredients is an easy way to eat more healthily.

8. Eating healthy is an important way to take care of your body and improve your quality of life.

9. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

10. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

11. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

12. He could not see which way to go

13. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

14. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

15. Her charitable spirit was evident in the way she helped her neighbors during tough times.

16. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

17. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

18. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

19. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

20. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

23. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

24. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

25. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

26. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

27. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

28. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

29. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

30. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

33. Many schools and universities now use television as a way to provide distance learning

34. One of the most significant impacts of television has been on the way that people consume media

35. She admired the way her grandmother handled difficult situations with grace.

36. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

37. Technology has also had a significant impact on the way we work

38. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. The invention of the telephone and the internet has revolutionized the way people communicate with each other

41. The rise of digital currencies and payment systems is changing the way people use and think about money.

42. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

43. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

44. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

45. They admire the way their boss manages the company with fairness and efficiency.

46. They are a great way to use up leftover ingredients and reduce food waste.

47. This can be a good way to grow your wealth over time, but it also carries risk

48. This can be a great way to leverage your skills and turn your passion into a full-time income

49. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

50. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

2. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

3. This has led to increased trade and commerce, as well as greater mobility for individuals

4. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

5. Paulit-ulit na niyang naririnig.

6. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

7. Kumain ako ng itlog kaninang umaga.

8. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

9. Walang nakakaalam kung saan sila napupunta.

10. They are building a sandcastle on the beach.

11. He blew out the candles on his birthday cake and made a wish.

12. She has been learning French for six months.

13. El agua es el recurso más preciado y debemos conservarlo.

14. They are not cooking together tonight.

15. My boss accused me of cutting corners on the project to finish it faster.

16. Ipinakita ng pamilya ni Maria ang kanilang pagtanggap sa pamamamanhikan ng pamilya ni Juan.

17. Magsusuot si Lily ng baro't saya.

18. Nahantad ang mukha ni Ogor.

19. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

20. She writes stories in her notebook.

21. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

22. Wala nang gatas si Boy.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

25. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

26. Bukas na bukas din ay kakain tayo sa labas.

27. Maraming mga taong nakakalimot sa kababawan ng kanilang sariling kalooban dahil sa pagsunod sa lipunan.

28. Hindi pa ako nakakapunta sa Barcelona.

29. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

30. Pagkat ikaw ay bata at wala pang nalalaman.

31. Marahil ay maulan bukas kaya't dapat magdala ng payong.

32. Ang poot ang nagpapahirap sa aking isipan at pumupukaw sa aking mga kilos.

33. Nakita rin kita! ang sabi niyang humihingal

34. Andre helte er stille helte, der arbejder i skyggerne.

35. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

36. Si quieres que la comida esté picante, agrega un poco de jalapeño.

37. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

38. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

39. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

40. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

41. All these years, I have been grateful for the opportunities that have come my way.

42. They plant vegetables in the garden.

43. Oh ano na? Hindi ka na sumagot?

44. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

45. Nakita ko sa facebook ang dati kong kaklase.

46. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

47. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

48. El internet ha hecho posible el trabajo remoto y la educación a distancia.

49. Ang paglabas ng impormasyon tungkol sa isang malaking skandalo ay binulabog ang buong bansa.

50. Unti-unting gumuhit ang ngiti sa mga labi niya.

Similar Words

kaawaynag-away-awayawaybuwayaSumuwaymahagwayKawayanlawayrailwayswaysalwaysna-suway

Recent Searches

connectwayeliteislavasquesbagohinanaprebolusyonbroadcastgayunpamanyumabangtinderapedrofacultytabingpinakamalapitamoyhubadtumalonkartonisinagotmagdapisopasasalamatwaysmagpagalingpinakamaartengprobinsyaforskelligemabihisankuninkasinggitarahapag-kainanmabigyankabutihansmallnasugatantahananganoonmatapangiigibkaguluhansaan-saanngunitmawawalahanapbuhaynaglalarokaniyangsigawkalannalalabingkungmatagalschedulepaladnagtataasmalalimengkantadapanimbangkanilasalatinlarawanbilisystems-diesel-runculturallunasdespueskasamasapatospaaralanunosdisposalarmedbabaetheynakakatabamaramieksamsapatformnagawangsapagkatnanlilimahidalitaptapsmiletahimikkinauupuanvaccineskikitasenadorfacebookbinge-watching1929bantulotinfluentialcertainsasamahanyunganunwritingbakasyonmakesmagamotnanghahapdipaghusayanyumanigubotumatawadconectadoscarbonchavitunconventionalmahabanggumagawanagmistulanganimenglandlalawiganteachumakyatawadilakamag-anakanotog,motionumalismataraysasayawinetoo-ordernagisingtanongreadingsagottamatibokbulongnaglalabamagpa-paskokalakiyourbawalmagtagoibasumibolmakukulaynanlilimosmagpapabunotpang-araw-arawnagpapaigibmagkasinggandanagwikangcountlesspagtawatigrelumindolnagwagihumblecomplicatedmaibibigaylagaslaslunesdisappointbaguiowhetherpaglisansisikatpusotuvoalineithermanilajennycarrieddagat-dagatanfireworksdumaancramemaagatungkodnapasubsoblayasyayamagtataniminaitinuringknightlumilingonlabassariliibonguhituntimelymatandaaaisshmatindingbuhaybugbugin