Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "way"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. All these years, I have been grateful for the opportunities that have come my way.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

5. By the way, when I say 'minsan' it means every minute.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Cooking at home with fresh ingredients is an easy way to eat more healthily.

8. Eating healthy is an important way to take care of your body and improve your quality of life.

9. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

10. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

11. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

12. He could not see which way to go

13. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

14. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

15. Her charitable spirit was evident in the way she helped her neighbors during tough times.

16. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

17. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

18. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

19. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

20. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

23. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

24. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

25. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

26. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

27. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

28. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

29. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

30. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

33. Many schools and universities now use television as a way to provide distance learning

34. One of the most significant impacts of television has been on the way that people consume media

35. She admired the way her grandmother handled difficult situations with grace.

36. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

37. Technology has also had a significant impact on the way we work

38. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. The invention of the telephone and the internet has revolutionized the way people communicate with each other

41. The rise of digital currencies and payment systems is changing the way people use and think about money.

42. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

43. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

44. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

45. They admire the way their boss manages the company with fairness and efficiency.

46. They are a great way to use up leftover ingredients and reduce food waste.

47. This can be a good way to grow your wealth over time, but it also carries risk

48. This can be a great way to leverage your skills and turn your passion into a full-time income

49. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

50. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. La tecnología ha permitido la creación de nueva música y la producción de grabaciones de alta calidad.

2. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

3. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

4. Higupin ng halaman ang tubig mula sa lupa.

5. En la realidad, las cosas no son siempre en blanco y negro.

6. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

7. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

8. The film director produced a series of short films, experimenting with different styles and genres.

9. Naglaba ang kalalakihan.

10. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

11. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

12. The website has a lot of useful information for people interested in learning about history.

13. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

14. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

15. Ipinagdiriwang sa Pilipinas ang araw ng kalayaan tuwing June 12

16. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

17. Pneumonia is a serious infection that affects the lungs.

18. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

19. Ano ho ang gusto niyang orderin?

20. Los bebés pueden necesitar cuidados especiales después del nacimiento, como atención médica intensiva o apoyo para mantener la temperatura corporal.

21. Malapit na matapos ang kanyang termino sa pagka senador.

22. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

23. Sige.. pupunta tayo sa Jeju Island next March 26..

24. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

25. Sa oras na makaipon ako, bibili ako ng tiket.

26. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. Ang may-akda ay nagsusulat ng libro upang ibahagi ang kaniyang kaalaman at karanasan.

29. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

30. Hindi umimik si Aling Marta habang minamasdan ang bata.

31. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

32. Tahimik ang buong bahay, waring walang tao sa loob.

33. I've been driving on this road for an hour, and so far so good.

34. Nakita niyo po ba ang pangyayari?

35. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

36. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

37. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

38. The relationship between work and mental health is complex and can vary from person to person.

39. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

40. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

41. The news might be biased, so take it with a grain of salt and do your own research.

42. Ang biograpo ay nagsusulat ng mga kwento ng buhay ng mga kilalang personalidad.

43. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

44. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

45. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

46. Maglalakad ako papunta sa mall.

47. This has led to increased trade and commerce, as well as greater mobility for individuals

48. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

49. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

50. Mas masarap ang pulotgata kapag inilagay sa ibabaw ng bibingka.

Similar Words

kaawaynag-away-awayawaybuwayaSumuwaymahagwayKawayanlawayrailwayswaysalwaysna-suway

Recent Searches

waymay-aripagkataocharmingnagsusulatkumalmaalbularyodeterminasyonthankbumibitiwpossiblemagsabiawitangatheramericasugatreorganizingchessjackycontinuednagdabogpagbebentahapdi1954individualsconectadossumunodpagtiisankayapagpanhiklangawmababasag-ulopagkatakotkinagagalaksapatospaumanhinbabasahinawitjulietbinibiniriyankinantamaputlanai-dialpalakolahaspinagsulatpagkataposgantingkasalananlugarmasusunodatinghimutokhumanoeditorpinagmasdandumalokaniyapinapasayadamitcitizensbubongpapanignag-aaralpuntahanmatuloglinenageespadahansagottwitchkatotohananmangkukulamaminbumangonleytenapaplastikanpanalanginsuchaeroplanes-allpagtatapossubalitbisitapesomaitimauditjoshuakaysizeipapainitmanagermahihirapmatalikarturoawalikuranhanginbarung-barongpinagmamalakiturnpag-aapuhappetroleummommyisamatuluyanumingitkirotedadjustinrosehinogalas-tresbibigkailanmancallermakatarungangbroadumakyatnapasigawkarapatandisciplinkinasomeinismaglakadjuanmakapangyarihangbagalmagkamalilinaapoysumusunobinabaliklalakengpakiramdamtanongpagsumamocanteenearningbanyohugismedievalgumuhitakintumayohonestomundodali-dalisourcemababawde-latapagpapasakitpresyonageenglishmakasalanangnakakagalingnahahalinhannangagsipagkantahanlasingeronagugutompracticesthereforemagsisinelumutangquicklycommander-in-chiefrealistichinawakanlaylaytutorialsoffentligemasikmurasumpunginpatalikodmasayahinmakatatlodependingelectoralgeneratecassandraenglishumutangitinaobincludingnapaiyakbabydatapwatnananaghilioffentlignakisakayagosmalapitannaglabadamapagkatiwalaannakasakaydinadasalmakasakaykabarkadanananaginipmabuti