Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "way"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. All these years, I have been grateful for the opportunities that have come my way.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

5. By the way, when I say 'minsan' it means every minute.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Cooking at home with fresh ingredients is an easy way to eat more healthily.

8. Eating healthy is an important way to take care of your body and improve your quality of life.

9. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

10. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

11. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

12. He could not see which way to go

13. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

14. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

15. Her charitable spirit was evident in the way she helped her neighbors during tough times.

16. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

17. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

18. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

19. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

20. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

23. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

24. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

25. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

26. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

27. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

28. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

29. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

30. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

33. Many schools and universities now use television as a way to provide distance learning

34. One of the most significant impacts of television has been on the way that people consume media

35. She admired the way her grandmother handled difficult situations with grace.

36. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

37. Technology has also had a significant impact on the way we work

38. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. The invention of the telephone and the internet has revolutionized the way people communicate with each other

41. The rise of digital currencies and payment systems is changing the way people use and think about money.

42. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

43. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

44. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

45. They admire the way their boss manages the company with fairness and efficiency.

46. They are a great way to use up leftover ingredients and reduce food waste.

47. This can be a good way to grow your wealth over time, but it also carries risk

48. This can be a great way to leverage your skills and turn your passion into a full-time income

49. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

50. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

2. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

3. Me siento caliente. (I feel hot.)

4. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

5. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

6. Binabaan nanaman ako ng telepono!

7. Sa pagdami ng mga tao, ang mga aso ay naging alaga nila sa kanilang mga tahanan.

8. Hindi pa marahil iyon nakakalayo; may ilang sandali pa lamang ang nakararaan.

9. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

10. Ako. Basta babayaran kita tapos!

11. He has been practicing yoga for years.

12. Håbet om at finde vores sande formål kan føre til stor personlig opfyldelse.

13. Magandang araw, sana pwede ba kita makilala?

14. No deberías estar llamando la atención de esa manera.

15. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

16. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

17. Sabi ko sa inyo, halos kumpleto kami kasi wala si Sync.

18. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng katangian ng isang indibidwal, kundi tungkol din sa pagpapakita ng kahalagahan ng malawak na kaalaman.

19. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

20. El nacimiento es el momento en que un bebé sale del útero de la madre.

21. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

22. The scientific community is constantly seeking to expand our understanding of the universe.

23. Lazada's mobile app is popular among customers, with over 70 million downloads.

24. Ang dalawang isinumpa ay namuhay sa kakahuyan.

25. Oscilloscopes can capture and store waveforms for further analysis and comparison.

26. Sa gabi, natatanaw ko ang mga bituin na kumikislap sa langit.

27. Ikinakagalit ko ang mga sakim na minahan.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. May napansin ba kayong mga palantandaan?

30. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

31. Madalas na may mga internasyonal na konferensya na ginaganap upang mapag-usapan ang mga usaping pangkapayapaan.

32. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

33. May mga kaulayaw ako sa trabaho na naging kaibigan ko na rin.

34. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

35. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

36. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

37. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

38. Ayaw niya ng maarteng palabas kaya lagi siyang nakatago sa kanyang kwarto.

39. Ang ganda naman nya, sana-all!

40. When in Rome, do as the Romans do.

41. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

42. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

43. Padabog akong umupo habang dumadating na yung order nya.

44. She draws pictures in her notebook.

45. El parto es un proceso natural y hermoso.

46. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

47. Cryptocurrency is often subject to hacking and cyber attacks.

48. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

49. The patient was discharged from the hospital after recovering from pneumonia.

50. May sinasabi ka ba? umiling ako sa tanong ni Kenji

Similar Words

kaawaynag-away-awayawaybuwayaSumuwaymahagwayKawayanlawayrailwayswaysalwaysna-suway

Recent Searches

waydispositivospinatutunayanpaglipaspusongcasesperfectpeopleproblemaincreasecubavictoriajoshrhythmtawadkalupieducationarabiatenderbiocombustiblessiguradomalakimatayogprovidemagdaanikinabubuhayanak-pawisnakakapagodnagigingmasdanjustinkulturinangiwanwishingnapakalamigmalikotmakapagmanehopamahalaansermagsasamafiamagsubomaliligonegosyoakofascinatingsupilinkayomahinogkotsenag-aalalangnasawifloorexpectationsnagsisikainmodernsignificantpamilyatuloyitimnahuhumalinginterpretingmakikipagbabagprogresswindowviewknightnapakalungkotitsuraumaasaibalikconsumet-shirtmasiyadoerhvervslivetbigongmagliniskapaligiranaaisshkatawangjolibeelagnatkabutihancomfortnagdadasalhadlangniyangtumamiskinalimutanpirasoingatancarecafeteriatinitirhanperyahankamiassportslilipadlayuansaanmommyisipanaayusinpieceshigh-definitionclubdevelopdalawamailapsandalinapadpadconventionalconditioningsalapiawitbabaenggulaynasasaktanhinamakpinakabatangnakaka-ininiuwi1973pag-itimnangahaskapagnuclearkasingetsyamendmentsthoughtsprovelegacybecomemahabaprodujoisaacfauxpagtuturopinasalamatanpahahanapnaunamakatayodiretsomarketing:variedadprocessespakipuntahanstateferrerpalengkepagdidilimtayopandemyanearnakangangangnahuliwarifeedback,kakaantayafternoonlugarrosasnabanggahomesmakapagsabitumalonjustevolucionadolakiibabaideatinapaykitatongdadalawinnakakaakitlingidestudioattorneyisubosimplengganyanmalilimutinanaysilaytinignakakatabamalilitsonpinakamasayaasawaposporopagbabantacniconanggagamotstarreddependactor