Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "way"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. All these years, I have been grateful for the opportunities that have come my way.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

5. By the way, when I say 'minsan' it means every minute.

6. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

7. Cooking at home with fresh ingredients is an easy way to eat more healthily.

8. Eating healthy is an important way to take care of your body and improve your quality of life.

9. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

10. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

11. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

12. He could not see which way to go

13. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

14. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

15. Her charitable spirit was evident in the way she helped her neighbors during tough times.

16. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

17. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

18. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

19. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

20. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

23. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

24. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

25. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

26. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

27. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

28. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

29. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

30. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

31. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

32. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

33. Many schools and universities now use television as a way to provide distance learning

34. One of the most significant impacts of television has been on the way that people consume media

35. She admired the way her grandmother handled difficult situations with grace.

36. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

37. Technology has also had a significant impact on the way we work

38. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

39. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

40. The invention of the telephone and the internet has revolutionized the way people communicate with each other

41. The rise of digital currencies and payment systems is changing the way people use and think about money.

42. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

43. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

44. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

45. They admire the way their boss manages the company with fairness and efficiency.

46. They are a great way to use up leftover ingredients and reduce food waste.

47. This can be a good way to grow your wealth over time, but it also carries risk

48. This can be a great way to leverage your skills and turn your passion into a full-time income

49. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

50. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

2. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

3. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

4. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

5. My best friend and I share the same birthday.

6. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

7. Nakaramdam na lang ako biglang may humampas ng ulo ko.

8. How I wonder what you are.

9. The teacher assigned a hefty amount of homework over the weekend.

10. Sa tulong ng mga batang nagsilapit, ang matanda ay nakatindig.

11. Anong pinag-usapan niyo ni Mommy? biglang tanong ni Maico.

12. Nagising na si Angelica matapos syang operahan sa loob ng limang oras.

13. Pumila sa cashier ang mga mamimili nang limahan.

14. Scientific research has led to the development of life-saving medical treatments and technologies.

15. Malinis ang kuwarto ng mga magulang ko.

16. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

17. Maya-maya lang, nagreply agad siya.

18. Napakagaling nyang mag drawing.

19. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

20. Pumunta ako sa Iloilo noong tag-araw.

21. Ang pabango ni Lolo ay nagbigay ng mabangong amoy sa kanyang kuwarto.

22. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

23. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

24. Oo nga babes, kami na lang bahala..

25. Sa facebook kami nagkakilala.

26.

27. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

28. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

29. Batang-bata ako nalalaman ko 'to.

30. Natawa sya, Nakakatawa ka talaga. haha!

31. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

32. She missed several days of work due to pneumonia and needed to rest at home.

33. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

34. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

35. Gusto ko pumunta, pero pagod na ako.

36. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

37. Danmark eksporterer også en betydelig mængde medicinske produkter.

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

40. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

41. Ngunit hindi napigilan si Magda ng kanyang mga anak.

42. Sa likod ng mga tala, kahit sulyap lang, Darna

43. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

44. Ang mabuting kaibigan, ay higit pa sa kayamanan.

45. Isasama ko ang aking mga kapatid sa pamanhikan.

46. The zoo houses a variety of animals, including lions, elephants, and giraffes.

47. Kinabukasan ay nawala si Bereti.

48. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

49. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

50. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

Similar Words

kaawaynag-away-awayawaybuwayaSumuwaymahagwayKawayanlawayrailwayswaysalwaysna-suway

Recent Searches

bagyotapatwaykerbbokmovingsinongmalumbaypagkakapagsalitapagbibiroiniuwimagalangnaghandangrawkinakabahanpacienciatamafriendsmagkabilangvedadditionallyeditorsafespecificnochemagisingpasannyabotantetumakbonakatuwaangnaglakadligaligskypekendiknightanimnahulaannungideologiesmakikitapodcasts,nagbakasyonpagpapatubomarketplacesmurang-murabalitapinahalatapinagkiskisdoble-karanangahasnanghihinapaga-alalapamamasyalpagpapasanpagtangishanginmagdamagantemparaturakongresotennismagpahabaairportinvestkumalmanaglahomabihisanginawarantumatawadnatinagbihirangmaghilamoshinihintaygumuhitnanangisnagsilapitika-12binigyangmailapmartiallagaslasisubosidovariedadbarangaypagdamisahodnuevopaghunipasalamatanexhaustedyeykumbentolalakenatagalanmabaitkumatokwastematulunginarturoasahanmartianpasaheunanvaledictorianmisyunerongbinawiankamalianmangingisdangdulotdettewestsoccertoreteanimoyiilanbestbingisuotmakalingforcesmapadalilastingthen1973sueloeffortscommunitymatchingsumakitpumulotmeremultonakakalasingstoplightcheckshimselfnagginghimlibrepracticadofurtherpaglalabanandali-daligumantilighttigretanyagresortsilbinglinapresencesinonormalgratificante,noongdollarmakikipag-duetonapapahintokaparehamoneynagsuotmagbibigaytagumpaydiyaryobakataong-bayantaposbobodilimmag-asawalinyapagbabantakanilapandemyasumisidmahinahongbakalkahaponsakintawagpakilagaypapuntangkasintahanbagkus,lumalangoytaopaghuhugashinampashinogbopolsaaisshgawintaingafiakagandadevelopedvariousscientistumalis