Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "till"

1. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

2. It ain't over till the fat lady sings

3. Till the sun is in the sky.

Random Sentences

1. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

2. The news might be biased, so take it with a grain of salt and do your own research.

3. The presentation was absolutely flawless; you did a great job.

4. Football has produced many legendary players, such as Pele, Lionel Messi, and Cristiano Ronaldo.

5. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. Have you eaten breakfast yet?

8. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

9. He thought it was a big problem, but in reality it was just a storm in a teacup.

10. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

11. Ako ngayo'y lumilipad at nasa langit na.

12. There are a lot of reasons why I love living in this city.

13. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

14. Gusto ko na magpagupit ng buhok.

15. Pull yourself together and stop making excuses for your behavior.

16. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

17. Tumagal ng ilang minuto bago natapos ang palabas.

18. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

19. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

20. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

21. Balak po naming bumalik sa susunod na linggo.

22. Inakalang nagtatampo ang kapatid niya, pero hindi naman pala.

23. TikTok has been banned in some countries over concerns about national security and censorship.

24. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

25. Magandang umaga po, Ginang Cruz.

26. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

27. I am writing a letter to my friend.

28. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

29. The management of money is an important skill that can impact a person's financial well-being.

30. Isang araw, may nanghingi ng kanyang ilang pananim.

31. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

32. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

33. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

34. Ang carbon dioxide ay ina-absorve ng mga puno.

35. I forgot your birthday, but here's a card anyway. Better late than never, right?

36. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

37. Think about what message you want to convey, who your target audience is, and what makes your book unique

38. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

39. Paano magluto ng adobo si Tinay?

40. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

41. Ngayon ang rambutan ay isa sa masasarap na prutas na makikita natin sa ating bansa.

42. Sa pagtitipon ng mga lider ng kompanya, ibinahagi nila ang kanilang mga mungkahi upang mapaunlad ang negosyo.

43. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

44. Sa harap ng mga bisita, ipinakita niya ang magalang na asal ng mga kabataan sa kanilang pamilya.

45. There are a lot of opportunities to learn and grow in life.

46. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

47. Ang taong nagigipit, sa patalim kumakapit.

48. ¿Cómo has estado?

49. If you did not twinkle so.

50. Ikinasasabik ni Armael ang pagpunta sa kasal.

Similar Words

stillfremstille

Recent Searches

tillnalakimahinogmachinescrecerpaungolcakemangkukulamatingsinunggabannakasakaymaritesmanilanagtitindakaagawhulyoconditionellananahimikpigingnakabluenangyayaridesarrollaronmagkasing-edadmagkakaroondisfrutarpasswordmabangissultankasogalitasobayanidespuesreplacednaglutotanawhoneymoonbalotcompanylimitedmalakingwesternuminomtrafficpagtiisannadadamaykarwahengneed,pagmasdanproducererpagkababamansanasnegosyantetulisanroomgusgusinggenerationspinuntahanmaputiibaliknangingitianlaruansalitatinangkapasigawkawayankasimabangomagigitingkagyatdinanaslakadpagpalitmakeiniibighanggangcarlotugonsistemapinakatuktokopisinacharismaticorasnasasalinansaberespadasinojoeiwasannapatinginlugawiyanmightmapangasawapunongkahoyfirstkailannapaluhodmapag-asangmitigatelunetaumuwingmagbigayanbilersinipangplayedsinumanrememberedbulongmalungkothinogpinagmamalakiisipdebatesnealuisrenacentistapitumponggatherteampantalongfacebookhihigamagpapakabaitmulasurroundingsnakatapatnatigilandadalawmaalikabokandoymay-bahaytumatakboampliatwo-partynagkasunogmagka-apodapit-haponhirammagbungapisitombalitangbagkusphilosopherbumisitapagtitiponmagsasalitaumiibignailigtaspelikulawikaunibersidadmaintainasthmatiketpag-uugaliinilabastutoringmanananggalbroaddamdaminplatformscryptocurrencymidtermbaulnanlalamigpanibagongmagpaliwanaglawahumintotipmagsubopagbabagoKinakainangkinamariangmatagal-tagalnagmamaktolgutomdiscoveredanywhereNatandaanhinahangaantumutubohikinggratificante,umiinomnapupuntacalciumKumuhamahalkapangyarihanofferhanginpahingalpodcasts,mayamaya