Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "yang"

1. Ada banyak kitab suci yang berisi doa-doa, seperti Al-Qur'an, Injil, dan Weda.

2. Ada banyak komunitas pecinta kucing di Indonesia yang berkumpul untuk berbagi pengalaman dan pengetahuan tentang kucing.

3. Ada berbagai jenis kucing yang ada di Indonesia, seperti kucing Persia, Siamese, dan Scottish Fold.

4. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

5. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

6. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

7. Apa yang bisa saya bantu? - How can I help you?

8. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

9. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

10. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

11. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

12. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

13. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

14. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

15. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

16. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

17. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

18. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

19. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

20. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

21. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

22. Danau Toba di Sumatera Utara adalah danau vulkanik terbesar di dunia dan tempat wisata yang populer.

23. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

24. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

25. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

26. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

27. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

28. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

29. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

30. Doa sering kali dianggap sebagai bentuk ibadah yang penting dalam agama dan kepercayaan di Indonesia.

31. Es teler adalah minuman dingin yang terdiri dari buah-buahan yang dicampur dengan sirup dan santan.

32. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

33. Gunung Bromo di Jawa Timur adalah tempat wisata populer untuk melihat matahari terbit di atas gunung berapi yang aktif.

34. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

35. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

36. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

37. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

38. Kebahagiaan adalah keadaan emosional yang diinginkan oleh setiap orang.

39. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

40. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

41. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

42. Kebahagiaan sering kali tercipta ketika kita hidup sesuai dengan nilai-nilai dan prinsip hidup yang penting bagi kita.

43. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

44. Kelahiran bayi adalah momen yang sangat penting dan dianggap sebagai anugerah dari Tuhan di Indonesia.

45. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

46. Keluarga sering kali memberikan hadiah atau uang sebagai bentuk ucapan selamat kepada ibu dan bayi yang baru lahir.

47. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

48. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

49. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

50. Kucing di Indonesia diberi makanan yang bervariasi, seperti makanan kering dan basah, atau makanan yang dibuat sendiri oleh pemiliknya.

51. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

52. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

53. Kucing di Indonesia sering diberi nama dengan arti yang unik dan lucu.

54. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

55. Kucing dikenal dengan sifatnya yang lucu, manja, dan lincah.

56. Kucing juga dianggap sebagai hewan yang bisa membantu mengurangi stres dan kecemasan.

57. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

58. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

59. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

60. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

61. Membangun hubungan yang mendalam dengan diri sendiri dan orang lain, serta merayakan momen-momen kecil, memberikan kebahagiaan yang tahan lama.

62. Membantu orang lain dan berkontribusi pada masyarakat juga memberikan perasaan kebahagiaan yang mendalam.

63. Mencapai tujuan dan meraih kesuksesan dapat memberikan perasaan kebahagiaan yang mendalam.

64. Menerima diri sendiri dan memiliki pemahaman yang mendalam tentang nilai-nilai dan keinginan kita sendiri juga membantu mencapai kebahagiaan.

65. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

66. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

67. Menghargai dan mensyukuri apa yang kita miliki saat ini merupakan kunci untuk mencapai kebahagiaan.

68. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

69. Menjaga kesehatan fisik dan mental juga berperan penting dalam mencapai kebahagiaan yang berkelanjutan.

70. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

71. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

72. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

73. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

74. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

75. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

76. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

77. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

78. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

79. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

80. Pantai Kuta di Bali adalah salah satu pantai terkenal di dunia yang menawarkan pemandangan matahari terbenam yang indah.

81. Pantai Sanur di Bali adalah pantai yang menawarkan pemandangan matahari terbit yang indah dan tempat yang bagus untuk bersantai.

82. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

83. Pariwisata religi menjadi daya tarik bagi wisatawan lokal dan mancanegara yang tertarik untuk mengunjungi tempat-tempat suci dan melihat praktik keagamaan yang unik di Indonesia.

84. Pecel adalah hidangan sayuran yang dicampur dengan saus kacang yang kaya rasa.

85. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

86. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

87. Pepes adalah makanan yang terbuat dari ikan atau daging yang dibungkus dengan daun pisang dan dimasak dengan rempah-rempah.

88. Pulau Bali memiliki banyak tempat wisata terkenal lainnya, seperti Ubud yang terkenal dengan seni dan budayanya serta tempat surfing seperti Uluwatu dan Padang-Padang.

89. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

90. Pulau Komodo di Nusa Tenggara Timur adalah rumah bagi kadal raksasa komodo yang langka dan merupakan situs warisan dunia UNESCO.

91. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

92. Rawon adalah hidangan daging yang dimasak dengan bumbu rempah khas Jawa Timur yang berwarna hitam.

93. Rendang adalah masakan daging yang dimasak dalam bumbu khas Indonesia yang kaya rasa.

94. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

95. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

96. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

97. Satu titik hitam bisa merusak noda yang putih.

98. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

99. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

100. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

Random Sentences

1. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

2. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

3. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

4. Ang pagpili ng lugar ng kasal ay importante upang masigurong magiging maganda ang setting.

5. Walang konsyerto sa plasa mamayang gabi.

6. The beaten eggs are then poured into a heated and greased pan.

7. Ilan ang mga puno sa bakuran ninyo?

8. Ang paglapastangan sa mga karapatan ng mga katutubo ay nagpapakita ng di-pagkakapantay-pantay sa lipunan.

9. Ano ba pinagsasabi mo?

10. Good morning, Beauty! aniya sabay halik sa mga labi ko.

11. She does not skip her exercise routine.

12. Kung sino ang maagap, siya ang magandang kinabukasan.

13. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

14. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

15. Sehari di negeri sendiri lebih baik daripada seribu hari di negeri orang.

16. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

17. Musk has faced controversy over his management style and behavior on social media.

18. Beauty ito na oh. nakangiting sabi niya.

19. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

20. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

21. Ang diploma ay isang sertipiko o gawa na inisyu ng isang institusyong pang-edukasyon

22. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

23. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

24. The company’s momentum slowed down due to a decrease in sales.

25. The singer on stage was a beautiful lady with an incredible voice.

26. Omelettes are a popular choice for those following a low-carb or high-protein diet.

27. Ang hudyat ay maaaring maging simpleng galaw o kilos, o maaaring isinasaad sa pamamagitan ng komplikadong simbolo o wika.

28. Maarte siya sa mga kainan kaya hindi siya mahilig sa mga fast food chain.

29. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

30. Hindi ako makapaniwala sa nakikita ko.

31. Kanser ang ikinamatay ng asawa niya.

32. Da Vinci fue un artista renacentista muy importante.

33. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

34. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

35. Pinaplano ko na ang aking mga gagawing sorpresa para sa aking nililigawan sa darating na Valentine's Day.

36. Itinago ni Luz ang libro sa aparador.

37. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

38. They are not running a marathon this month.

39. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

40. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

41. The pretty lady in the movie stole the protagonist's heart.

42. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

43. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

44. Effective use of emphasis can enhance the power and impact of communication.

45. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

46. He practices yoga for relaxation.

47. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

48. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

49. Since wala na kaming naririnig medyo kumalma na ako.

50. They do not forget to turn off the lights.

Similar Words

niyangsiyangMasayang-masayamamayangkanya-kanyangpamilyangnyangsyangmagsayangkayangmasayangkanyangnahihiyangkayang-kayangkaniyangmalayangsadyangtuluyangipinasyangBusyangkaaya-ayangkasalukuyangmarangyangpanghihiyangMasayang-masayangEspanyangBinigyangbiyayangbayangkababayangbahagyangkatibayangsiyang-siyanagyayangkanayangsadyang,

Recent Searches

yangtilpresidentepatawarinnanaigangkingreloperangebidensyafarmipagmalaakidisyemprepopularizemabangopagtitindakotsesumigawtomarnakahigangitlogmarahilpagkatmahalagacruzskirtpakakasalanlunespisaratuloy-tuloymalakingibinigaykinagagalakbentangkinabibilangannanamankumakainumiibigbahay-bahayannagwalishawakmananaloramdampinakainnagdaankerbpakialampulangmaritesnicolasanimobakehvorsang-ayonbaroclipnaantigt-isapinag-usapannasalumampasinalagaanpaglalabadadaangitinuturonababasaeroplanokatulongsakopreaksiyongivebayaningmanalomangungudngodmanykatagangmagbungaginoongmarasigannaputolpagkabuhayhumaboleditorumabogmabagalmakakatakasmamimilikahoynagawangumigibtigreipagbilihalamanmagalingaraw-arawpaalissasagotconsistmasinopsagasaanpalagaynananalongtelecomunicacionesnakinigperpektopaboritongnapakabutimakatarungangnasantinagalungkutipipilitkainitandosenangnabitawanuugod-ugodhinanakitnagpipilithongsariwahumahangoswesttabakakayurintumambadlimossagotindvirkningmagtipidspecialsusibagongmakuhayayakunehonohsyangincrediblesagingnagpasyacamerapitakanakasakitiskomabiliskasalukuyanpanghabambuhaypalapagrenaiapusakombinationyourpagpapasakitmaluwangnabagalanagostobaccooccidentalkutsilyoopportunitymaynakatanggapnatutokmaghugasnadadamaymataposrosariokababaihanbibigyanfarmagpahabamagdaraoscalambasarapkatutubopaglipaspagdiriwangkawili-wilihumihingalmataaaskatedralbungaditaknahuliginugunitababoyasulbumibitiwkaugnayan4thcardigancivilizationpulubibinatonaglulutoanitopaghahanguanexamkamakalawabahalabahaging