Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "commerce"

1. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

2. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

3. Lazada is an e-commerce platform that operates in Southeast Asia.

4. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

5. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

6. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

7. This has led to increased trade and commerce, as well as greater mobility for individuals

Random Sentences

1. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

2. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

3. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

4. Maraming mga bata ang mahilig sa pagguhit dahil ito ay isang paraan upang magpakita ng kanilang imahinasyon.

5. Sa Manila Hotel ka titigil, hindi ba?

6. Nakaupo ako nang matagal sa sinehan.

7. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

8. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

9. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

10. El momento del nacimiento marca el inicio de una nueva etapa en la vida de los padres.

11. Has he finished his homework?

12. The new restaurant in town is absolutely worth trying.

13. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

14. Proud ako sa kultura at tradisyon ng mga Pinoy.

15. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

16. Na-promote ako sa higher position sa aking company kaya masayang-masaya ako ngayon.

17. There?s a world out there that we should see

18. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

19. Las hojas de los cactus son muy resistentes y difíciles de cortar.

20. Nakakamiss kumain ng pulotgata tuwing tag-araw kasama ng pamilya.

21. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

22. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

23. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

24. Gusto mong mapabuti ang iyong kasanayan? Kung gayon, magpraktis ka araw-araw.

25. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

26. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

27. Anong wala! pasinghal na sabi ni Aling Marta

28. Nagplano akong maglakad-lakad sa park, datapwat bigla akong tinawagan ng aking kaibigan para magkape.

29. Durante el trabajo de parto, las contracciones uterinas se hacen más fuertes y regulares para ayudar al bebé a salir.

30. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

31. Madalas na naglulusak sa dumi ang mga bakuran.

32. Ang aming angkan ay mayroong mga tradisyon sa pagdiriwang ng mga okasyon.

33. Batman, a skilled detective and martial artist, fights crime in Gotham City.

34. Pabili po ng tiket papuntang Calamba.

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

37. Les élèves doivent travailler dur pour obtenir de bonnes notes.

38. Eating healthy is essential for maintaining good health.

39. The chest x-ray showed signs of pneumonia in the left lung.

40. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

41. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

42. Napakabilis ng agaw-buhay na pagbabago sa mundo ng teknolohiya.

43. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

44. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

45. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

46. Football is a popular team sport that is played all over the world.

47. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

48. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

49. They are cooking together in the kitchen.

50. Masahol pa kayo sa mga hayop! Dahil sa inyong makasariling pagnanasa ay nagawa ninyong saktan ang ibang tao.

Similar Words

e-commerce,

Recent Searches

obstaclescommercemalezakasuutanthanklaybrarinakiramaylumitawnearkommunikererpagtatakalumingonnakagalawtutubuinnakumbinsipamilyangmasiyadopamilihanmagturokapagimpennag-isipherramientaipinatawaginuulamdiyannanonoodpananakopkumustapasasalamatkalabanlaranganilognapatunayaninasikasomismokailanmanuwakeroplanomunalintameansbinibiniactivitypageantnariningmotiondahonespecializadasmakakawawaalikabukinreserbasyonhealthiernagkwentodapit-haponnakakagalawesterntumibaypaglisangulatmedisinaunconstitutionalsorrynetomapahamakmangresultmaliwanagmedicineadgangamericadistanciamateryalesjosiehonestotaostaga-ochandogospelnakilalaailmentsnagdudumalingnahuhumalingnatitirahistoriabahalakumikinigpagngitipondokumikilosnangahasmasayahinnagtatakbonakakatawafotosmensajesclubnatatawasuzettelumutanglumilipaddropshipping,naghilamospasyentepinangalanangitinatapatsinapakgagawinnagmamadalisikre,nakapaligidknowsinvestpuntahantumikimmangyayarinalulungkotpamburanakapangasawakinikitasportssaranggolanakaupopinakamahabasinisirakinumutanaccessninumanano-anoulamdraybercanhinimas-himasnagpapaniwalagayundinnakadapahiwagangipingnapanangingitngitpakikipagbabagpagtangispresence,deliciosamahahanaysakristanturismosasabihinmanghikayatkinikilalangnaguguluhangpinabayaannagandahanpagtiisanjokepesosipinangangakmaligayamalilimutannagplaysiguroobservation,exigentede-latakonsyertoestadosbilihinsaktanpabilicynthiapigilantrafficrestawanmatindingpsh1980abonooliviastillclasesseeburgerabalanyagatheringsubalitbabesalokdiyaryokagubatancardigangawainautomatiskhanapbuhaypatakbomangyarinanunuksomaanghanglabinsiyamsoreprodujo