Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "upwork"

1. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

Random Sentences

1. The king's legacy may be celebrated through statues, monuments, or other memorials.

2. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

3. Paano mo pinaghandaan ang eksamen mo?

4. i Maico. Pagkuwan eh parang batang nagdabog siya.

5. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

6. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

7. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

8. Nasa kanluran ang Negros Occidental.

9. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

10. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

11. Jodie at Robin ang pangalan nila.

12. Limitations can be viewed as opportunities for growth and personal development.

13. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

14. Nagbabaga ang pakiramdam ng kanyang balat dahil sa matagal na pagkabilad sa araw.

15. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

16. The telephone has also had an impact on entertainment

17. Kalaro ni Pedro sa tennis si Jose.

18. The birds are not singing this morning.

19. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

20. Sa ilang saglit ang matandang babae ay naglaho at ang lugar na dating kinatitirikan ng kanyang bahay ay naging lawa.

21. Les astronomes étudient les étoiles et les galaxies.

22. Magsasalita pa sana siya nang biglang may dumating.

23. Pati ang mga batang naroon.

24. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

25. Los héroes son reconocidos y celebrados por su valentía y altruismo.

26. El algodón es un cultivo importante en muchos países africanos.

27. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

28. Ordnung ist das halbe Leben.

29. Ang buntot ng saranggola ay mahaba at makulay.

30. Musk has been involved in various controversies over his comments on social and political issues.

31. La labradora de mi colega es muy sociable y siempre se lleva bien con otros perros.

32. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

33. Wala yun. Di ko nga naisip na makakatulong. aniya.

34. Palibhasa ay may kakaibang pagtingin sa mga bagay dahil sa kanyang malawak na kaalaman at pag-unawa.

35. Hinimas-himas niya yung likod ko pagkalapit niya saken.

36. Arbejdsgivere tilbyder træning for at forbedre medarbejderes færdigheder.

37. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

38. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

39. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

40. I admire my mother for her selflessness and dedication to our family.

41. Pumunta ako sa Iloilo noong tag-araw.

42. Tumawag ako kaninang umaga pero wala ka.

43. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

44. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

45. Gusto mo ba ng isa pang tasa ng kape?

46. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

47. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

48. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

49. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

50. I got a new watch as a birthday present from my parents.

Recent Searches

upworknamungacaketelanagagamitiniuwifarmkaragatannatitiramalakimagpakasalnag-aasikasosalitangstartedtayosetsemphasispartemayakapsaidnapag-alamananotinakasanrealapatnapuwatawatmagkaibiganlaganaputilizanmasayangyungkapalsinabipinipilitmachinestoynahawakanpamamasyalnakalilipassabadongnagpaiyaknakakagalafotoskasangkapankaloobanghila-agawanmusicianmagbibiyahenagtatamponakatayosalamangkerokagandahagmarketplacesnakapapasongkahirapanpinakamagalingpodcasts,cultivopotaenabarung-barongpoliticalnalulungkotspiritualnagtitindanakakapagpatibaynagpapaniwalanagkitanagtatrabahobiocombustiblespagluluksanakaliliyongnagtataenapatigilnagpalutonapuyatlumilipadngumingisiintindihinyouthnapakagandakinumutaninuulcernapatulalaengkantadangkamiasnaiilangmatchingmangahastv-showskaninumannakahugnapalitangmagkaharapkahonmagagawapag-ibignaglabadateknologilinggongmananalonagsuotrektanggulopagkaawaamericapadalasbangkangmbricosakopinangaralaninilabasdumilatmaghapongmaaksidentetigassellingdisposalanghelmagkasinggandalivesnuhknowsnathanpookdelnagreplyblueorderinbinigyangunderholderso-calledchavitmamamanhikandulotendermediumboboperfectsumabogbalingeffortsdettereturnedkanto1940carebackpracticesmakingstopbroadcastshellonicecasesdeclaremotionmaglalakadkarapatangpagkagustoguerreroperwisyokinahuhumalinganeffort,buslokasingislanumerosasdulotipaliwanagespigasanimoybecomecivilizationrabejoshspentmaramimanuscriptroomwestkerbkapasyahanpebreroritwalplacesellcryptocurrency:taksilaborhydelcryptocurrencymaitimpedrorhythmtools,bilhinmaglakadhumanoaalissumakitpatay