Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "upwork"

1. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

Random Sentences

1. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

2. Limitations can be a result of fear or lack of confidence.

3. Hindi na niya narinig iyon.

4. They have been running a marathon for five hours.

5. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

6. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

7. Baka puwedeng hiramin mo ang iyong lawnmower para ayusin ang aking bakuran.

8. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

9. Eh what's the big deal ba? Parang kasama lang kahapon eh.

10. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

11. Kumain na tayo ng tanghalian.

12. All these years, I have been making mistakes and learning from them.

13. The company used the acquired assets to upgrade its technology.

14. The dancers are not rehearsing for their performance tonight.

15. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

16. Maaf, saya tidak bisa datang. - Sorry, I can't come.

17. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

18. Ang lahat ng problema.

19. Bawal ang maingay sa library.

20. Ikinasuklam ko ang ginawa ni Pedro.

21. Napatingin yung 7 na babaeng classmate namin na naguusap.

22. Nakaakma ang mga bisig.

23. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

24. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

25. Nami-miss ko na ang Pilipinas.

26. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

27. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

28. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

29. Mathematics is a language used to describe and solve complex problems.

30. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

31. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

32. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

33. Naghanda sila para sa kasal na gagawin sa bundok.

34. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

35. Tsuper na rin ang mananagot niyan.

36. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

37. Members of the US

38. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

39. Naglipana ang mga ibon sa hardin ngayong tag-araw.

40. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

41. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

42. Gumagawa ng tinapay si Tito Mark sa kusina.

43. Ganun? ok. disappointed na sabi ko.

44. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

45. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

46. La escasez de agua es un desafío global que afecta a muchas regiones del mundo.

47. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

48. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

49. Inutusan niya si Pinang na magluto ng lugaw.

50. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

Recent Searches

sistemasincludeupworknakikihalubiloclassmatelumalaonpa-dayagonalprogramapracticesumilingmagsaingcomputere,pinalakingstyrerfallalikelyskillshablabahagikgiktheirmalamigsakaanyobinatisections,arawpadermedicalkitbuhaybaketmabangotiyakpagtataposmalambotpakialambanyoeconomichinahaplosbanlagcultivationbusydividesnagpatuloymasyadonghayaangpamburacandidatescanadathroatkadalagahangkarunungannakaluhodnai-dialpangitcleannapahintoumibigseparationnerissareallyadverselydisfrutarinuminherunderlalargafeelingutilizamahahababetweenvaliosaginoongahitlandasnatakotkanikanilangtaxicommercialcarscompaniesfotossasakayairportpakakatandaanofrecenbulalaserlindaafterinatakehumanovictoriaanapandemyasinabipakakasalanmakalaglag-pantyipinamiliyaribaku-bakongmasasayaginaonline,napakagandangagilapaidmahinafiguremagkahawaknakaangathydelnapabayaannatitiralordgeardemocracypakainparoimagespaghalakhakpahabolfactoresmasayahinantibioticsbukasreboundbultu-bultongagaw-buhaypinamalagi18thstarperfectbayaningkadaratinginnovationdistansyatumawagbakitadiktumatawababalikpebrerokangitantmicacomunicarsengisimahabolnahihilomagpagupitbilissurveysfamenatulogsinapakbilernglalabataposkainresignationmahalagapetsatanghalichildrennagdabogcakeprobablementenagkalapittanimkuripotmagkasinggandapintoconditioninghacerberegningernagpaalamsettinglumulusobcontinuemakawalalutuinmananakawinaapikulisapibabawhapdirememberedkuneindividualsputolkikitamakasalanangnakapagreklamopetnasiyahanlegendsaralkinukuyomiguhitnakuhanaliligonaghuhumindig