Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "mood"

1. Eating a balanced diet can increase energy levels and improve mood.

2. Haha! Bad mood na bad mood ka ah?

3. Tumango lang ako. Wala ako sa mood na magsalita.

Random Sentences

1. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

2. Malilimutin siya sa mga pangalan ng tao kaya’t lagi siyang nahihiya sa pakikisalamuha.

3. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

4. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

5. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

6. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

7. Ngunit may isang bata ang may bulate kaya lagi siyang walang gana.

8. Mobiltelefoner, tablets og computere er eksempler på elektronik, som mange bruger hver dag.

9. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

10. Naputol yung sentence ko kasi bigla niya akong kiniss.

11. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

12. Ayaw mo ba? tanong niya sa malungkot na tono.

13. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

14. Dogs can be trained for a variety of tasks, such as therapy and service animals.

15. The French omelette is a classic version known for its smooth and silky texture.

16. Hindi na siya pumasok para maabutan lang ang dalaga, ngunit, sa kasamaang palad hindi niya ito inabutan.

17. We have visited the museum twice.

18. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

19. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

20. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

21. Akala ko nung una.

22. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

23. She has been exercising every day for a month.

24. Jacky! magkasabay na sabi nung dalawa.

25. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

26. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

27. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

28. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

29. Mangungudngod siya, mahahalik sa lupa.

30. Sa pagsalubong ng Bagong Taon, ang langit ay hitik sa mga kulay sa pamamagitan ng mga paputok at mga fireworks display.

31. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

32. Maraming tao sa tabing-dagat sa tag-araw.

33. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

34. Mathematics provides a systematic and logical approach to problem-solving.

35. The tree provides shade on a hot day.

36. Les travailleurs peuvent participer à des programmes de mentorat pour améliorer leurs compétences.

37. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

38. Electric cars have a lower center of gravity, which can improve handling and stability.

39. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

40. She's always gossiping, so take what she says with a grain of salt.

41. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

42. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

43. I am not watching TV at the moment.

44. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

45. They have been volunteering at the shelter for a month.

46. Algunas heridas, como las provocadas por mordeduras de animales, pueden requerir de vacunación antirrábica o tratamiento contra el tétanos.

47. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

48. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

49. Wala naman. I think she likes you. Obvious naman di ba?

50. Advances in medicine have also had a significant impact on society

Recent Searches

criticsnagbungasumindibansamoodatentopocatiyauncheckedsumangellamuchoskumarimotcomemamiyestenwatchyanmeetroboticnagreplybagoyounglayuninyonbulacandidateshockbelievedstudenthitkartongenerateiosworrysumalaanibroadcastingbathalafrogmaputimaratingmakesmichaelclientesoffentlighapdihulingrelativelyupworkganapmedyocreatemakapilingpoliticalefficientquicklypasinghalwithoutseparationfallstartedpackagingcallingbetabackmonitorlugarsimulamobilemalambinggagambatambayankausapincramekontratageneratedpasensiyamaluwagstandpantalontumatawadmeriendalandepulongarghsenadordyipworkingdialledporlingidtabledatanagbasaamingtapegabi-gabibumugamakabawifeedbackipinagbilingbinatangnuhpinakamahabapagkasabinagpabayadkinakaintmicalumakasminamahalhacer1982pagpanhikthroughoutpagsalakaylumiitnag-aaralsulyapatinupuanlabananlever,effectssalestotoongnanghihinasadyangsinapakenergyexamcomputerpatientgagnakabawio-orderseenlumamangtinungoinspiretechnologynakikiaotrasmayroonredigeringnagbibiromaaksidentegawincnicosapotsuzettebalingbaranggayforcesspamagka-babydaraananmaalwangmagpahingapasalamatanwakasemocionalmakausapsabongmanaloininomhawlahinatidtuyosaktanlaki-lakigeologi,naglalatangbiocombustibleskumukuhamagkakailamusicianmanlalakbayobservererpaki-translatenakikilalangkumakalansingikinamataypare-parehointernacionalolivamakalipasmagpagalingartistasnapapatungonagsisigawpagkagustonanamannagmistulangcourtmagpapagupitkabundukanlumilipadaplicaciones