Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "evolved"

1. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

2. The concept of money has been around for thousands of years and has evolved over time.

3. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

4. The nature of work has evolved over time, with advances in technology and changes in the economy.

5. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

6. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

7. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

Random Sentences

1. Binibigyang halaga ng mga Pilipino ang talambuhay ni Dr. Jose Rizal bilang isang pambansang bayani.

2. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

3. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

4. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

5. Nang sumapit ang ika-12 ng hating gabi, nagpalit ng anyo ang kakaibang pusa.

6. I have been swimming for an hour.

7. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

8. El powerbank utiliza una batería recargable para almacenar energía.

9. Ibinigay niya ang kanyang pera para matugunan ang mga pangangailangan ng komunidad.

10. Oo nga babes, kami na lang bahala..

11.

12. Huwag ring magpapigil sa pangamba

13. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

14. Hindi dapat sumuko agad kapag mailap ang posibilidad ng tagumpay.

15. May pumupunta sa Seasite minu-minuto.

16. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

17. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

18. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

19. Sa dapit-hapon, masarap mag-meditate at mag-isip-isip sa mga bagay-bagay.

20. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

21. Bukas ay magpapabunot na ako ng ngipin.

22. Hindi niya tinapos ang kanyang proyekto sa tamang oras, samakatuwid, hindi siya nakasali sa kompetisyon.

23. Ang haba ng prusisyon.

24. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

25. Pawiin mo po sana ang kanyang karamdaman.

26. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

27. Nakatira si Nerissa sa Long Island.

28. Pero salamat na rin at nagtagpo.

29. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

30. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

31. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

32. Make sure to keep track of your sources so that you can properly cite them in your book

33. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

34. Lumipad palayo ang saranggola at hindi na nila nakita.

35. Sinabi niya walang kapatawaran ang pag-iwan at pagpalit nito sa babae ng kanilang pamilya

36. Oh di nga? Nasaang ospital daw?

37. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

38. Disente tignan ang kulay puti.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Ano ang ginagawa niya sa gabi?)

41. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

42. She does not use her phone while driving.

43. The cat was sick, and therefore we had to take it to the vet.

44. He's always telling tall tales, so take his stories with a grain of salt.

45. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

46. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

47. Sa sobrang pagpapatubo sa perang ipinauutang, galit na galit ang mga mangingisdang hindi makapalag sa kaswapangan ng kanilang kababayan.

48. ¿Qué música te gusta?

49. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

50. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

Recent Searches

evolvedwithoutviewflashnegativedraft,nanghuhulitagalmakasakaydaanitinalicondonagreplyrichso-calledchoicebelievedsobrajanebabesmaaliwalastig-bebeintemalakasgovernmentsquatterbuwancontinuedinteriorelectionsmaputifatalspaghettibyespeednalasingilanemailcitypirasoredespadredivisorianag-aabangremainbilisclockumiibigevolucionadoalitaptapmaniwalapinaglisensyapanggatongpasosrangecoursesayokopuntatsespecialpamagattherapynationalnapasubsobsarakumalmapaghangatinahakenfermedades,pinaglagablabnatakoterhvervslivetbilibidbahaypangungutyakablankindergartenkausapinkinakabahanmag-aaraltuyoareasangstaydadalawnag-pouttaga-hiroshimanaglalaronagpabayadstarted:gataspaslitiniangatkumakapalpunong-kahoynoongibiliperaopomurangcountlessadaptabilitypasswordimagespagsalakaynakatapatcaretwo-partypatakascosechaspacesettingheartbeatmawalatelephoneamingbalahiboinspirasyonwalkie-talkiesusulitmaingayisdaikinalulungkotartistaspropesorteknologimakabawitinginadikresultlalabhansumasakaymagsimulamallsmilesadyangwalongmakalipaspepepiertapekasamaangbilhinlondonunoartificialpagmamanehomagpalagoaktibistabalitapag-alagamarahananongthanksgivingnasilawdisseiskedyulmaidhesuseksenaasincadenapicspsychenag-aalalangkalimutansalitangnakahigangnagmamadalidegreeseclipxekananmagkasinggandaumibigchefmagingelectronicareaconcernkulogattentionyelomorenapangitbansanghinigitmagisingsofauponarmedbadingmournedtutorialsinvolvehellotimemedyoibonmulighederpaskong