Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "evolved"

1. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

2. The concept of money has been around for thousands of years and has evolved over time.

3. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

4. The nature of work has evolved over time, with advances in technology and changes in the economy.

5. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

6. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

7. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

Random Sentences

1. Naglinis kami ng bahay noong Linggo.

2. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

3. Bagaimanakah kabarmu hari ini? (How are you today?)

4. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

5. Les élèves doivent travailler dur pour obtenir de bonnes notes.

6. Good morning din. walang ganang sagot ko.

7. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

8. Agad niyang dinala ito kay Mang Sanas.

9. Bago magsimula ang kasal, nagdaos sila ng tradisyunal na ritwal upang basbasan ang mag-asawa.

10. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

11. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

12. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

13. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

14. They have been studying science for months.

15. Sampai jumpa nanti. - See you later.

16. Dapat nating linisin ang mga kubyertos bago natin gamitin.

17. Las suturas se utilizan para cerrar heridas grandes o profundas.

18. Nag-aabang sa langit, sa mga ulap, sumisilip

19. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

20. Ang batang matuto, sana sa matanda nagmula.

21. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

22. Eine starke Gewissensentscheidung kann uns helfen, unsere persönlichen Werte und Überzeugungen zu verteidigen.

23. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

24. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

25. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

26. Sa gitna ng kagubatan, may matatagpuan kaagad na malalaking punong-kahoy.

27. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

28. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

29. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

30. Protecting the environment can also improve public health by reducing exposure to harmful pollutants and chemicals.

31. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

32. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

33. There were a lot of boxes to unpack after the move.

34. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

35. International cooperation is necessary for addressing global environmental challenges, such as climate change.

36. Unser Gewissen kann uns vor schlechten Entscheidungen bewahren und uns auf den richtigen Weg führen.

37. Beast. sabi ko pagkalapit sa kanya.

38. Nag-iisa siya sa buong bahay.

39. I am not exercising at the gym today.

40. Supporting policies that promote environmental protection can help create a more sustainable future.

41. Ang mga kasapi ng aming angkan ay nagkakaisa sa pagtatrabaho para sa kinabukasan ng pamilya.

42. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

43. Elle peut être interne, c'est-à-dire provenant de soi-même, ou externe, provenant de l'environnement ou de la pression sociale.

44. Kanino ka nagpatulong sa homework mo?

45. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

46. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

47. The woman walking towards me was a beautiful lady with flowing blonde hair.

48. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

49. Bawal magtapon ng basura sa dagat dahil ito ay nakakasira sa buhay ng mga isda at iba pang karagatan.

50. A quien madruga, Dios le ayuda. - The early bird catches the worm.

Recent Searches

fewevolvedgayapagamutankampanabuksanpagtawasadyang,tinitignanmag-amakainanblueslangawkaliwasunud-sunurantapossingaporeisulatbadareasalignsvivayumabongsakasopasyearsinvestkulungandangeroussimbahannagkaganitonagpa-photocopykamag-anakbalangmataasdietnag-replybuhaycapacidadesiwasiwasikinuwentokutsaritangbutdaraananalintrueeducationhigaparinmamasyalpag-alagasurveysulameksenanapadpadpinagsanglaannakaraangrespektivedoble-karaipapaputolstrategiesnagsisipag-uwiannatuloysahodandreanicena-suwaysingsingkaraokebuspananghalianpasensiyananaisindivisionwonderskinuskosmangingisdak-dramaselashiftpesoafternooniniunatmakabawibriefuniversitiesrawtinigilanlargerailfallgappinauupahangbulaklakmateryalestsinamembersnayonnamumuonagbabaganakakamangharitwal,establishedgawamaliitcommissioneffektivtthankecijaboboclocknaritodatapwathinanapipinangangakligajeepaseansummitkasaganaankindsproduktivitetnamalaginapaplastikanpinagsasabioverentrefavorremainmakausapnagpapanggapcompletecertainpuedenschedulesuchkargangmonumentopamagatandamingsweetraymondmagsasakadalawinbituinbecomesdahilmaaarinaminrepublicancornertagilirannilapitankusineronakatapostirantetrajeingaypalusotpagsusulattahananrabeparanglendwhichnanalonitongrizalpag-itimnagkapilatregulering,initsinigangpicsangelapaginiwanpulangmalidiscoveredmelvinmahigitawitannakangangangmapapagkakayakaptakestaoscabletubigabenemananagottonyopinagnaniniwalamissfaceisinakripisyoagadt-ibangpower