Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "evolved"

1. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

2. The concept of money has been around for thousands of years and has evolved over time.

3. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

4. The nature of work has evolved over time, with advances in technology and changes in the economy.

5. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

6. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

7. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

Random Sentences

1. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

2. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

3. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

4. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

5. Isang matandang lalaki naman ang tumikim sa bunga.

6. The team lost their momentum after a player got injured.

7. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

8. Have we missed the deadline?

9. Hindi ka puwedeng pumasok sa unibersidad.

10. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

11. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

12. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

13. Nag toothbrush na ako kanina.

14. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

15. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

16. The acquired assets have already started to generate revenue for the company.

17. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

18. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

19. Sa takot ay napabalikwas ang prinsesa at tinungo ang isang malapit na hukay.

20. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

21. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

22. Ano ang ginawa mo noong Sabado?

23. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

24. The company's profits took a hefty hit after the economic downturn.

25. Maglalaro nang maglalaro.

26. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

27. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

28. Ang tunay na kayamanan ay ang pamilya.

29. Wag kang magtatanim ng sama ng loob sa kapwa.

30. All these years, I have been grateful for the opportunities that have come my way.

31. Itinapon nina Fred at Melvin ang basura

32. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

33. The company's acquisition of new assets will help it expand its global presence.

34. Ipinakita ng pamilya ni Maria ang kanilang pagtanggap sa pamamamanhikan ng pamilya ni Juan.

35. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

36. Gabi na po pala.

37. Ang kumbento ang madalas tambayan ni Father at Sister.

38. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

39. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Elije el lugar adecuado para plantar tu maíz

42.

43. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

44. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

45. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

46. Ang ganda talaga nya para syang artista.

47. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

48. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

49. Kapag may kailangang desisyunan, hindi maiiwasan na magkaroon ng agam-agam sa kung ano ang tamang hakbang.

50. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

Recent Searches

studiedevolvedblognaglulutoistasyontangekskidkirankalakimakukulaynalalabingiloilomaipagmamalakingnagcurvephilanthropymagkakaanaknakapagreklamonakapangasawaposporonanlilimahidnapakahangacultivarmagagandangpamahalaankikitalumiwagkarwahengsaranggolabibisitakalakihanressourcernerenombresasabihinmanghikayatpaki-drawingdeliciosauusapannagkwentoluluwaspagdukwangmag-galanakasandigtinungosasakaypakinabangannagbabalakapitbahayumagawhanggangpagkaawamasyadongmagdamagkanluransittingdiedpagbabantatrentanagsamaminatamislagnatpundidonaliligoseryosongdiyankumampirenacentistananangistandangnaabothabitsbihirangwriting,diferentesafternoonnaiinisnglalabapinansinkaratulangpagbatidagatliligawanpabilifollowingbawalpaaralanbarreraspakibigyansubject,surveysbefolkningensakalingtransporttulonglilikomoneyginadakilanghinagisgusaligawinglandastaksigatolmayakainbinatilyobutaskabarkadalangkaylupainkunditelapnilitkakayananginastabantulotlaamangmatitigaspalakaasiaticpinaginakyatnapapikitofrecenmaalwangtulalaangelasakimngisiikinabubuhaylinawtalentsonidostrugglednaglabanansundaelipadkanannahihilokatapatsagapmalikotmulikapatidamerikadiagnosticidolproductiontonightawafonosmedyomemberssumakaybingoplacesakinmodernaccederdawsamfundisiptakespeepbecomebakitmaluwangpagbahingaaliscryptocurrencywatchingmatchingboksingparasinipangdinalawhydelmulighedbasahanmillionspangulocuentancebubiggestshowoutlinesdeathavailablegandaagabipolarenforcingmapadalireportipapainitaddressipipilitkiloofferauditpinunit