Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "legacy"

1. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

2. Einstein's legacy continues to inspire and influence scientific research today.

3. Einstein's legacy continues to inspire scientists and thinkers around the world.

4. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

5. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

6. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

7. In the years following his death, Presley's legacy has continued to grow

8. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

9. The king's legacy may be celebrated through statues, monuments, or other memorials.

10. Today, Bruce Lee's legacy continues to be felt around the world

Random Sentences

1. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

2. Omelettes are a popular choice for those following a low-carb or high-protein diet.

3. Los ríos y lagos son fuentes importantes de agua dulce.

4. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

5. Maganda ang ginawang dekorasyon sa cake ni Abigael.

6. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

7. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

8. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

9. The basketball court is divided into two halves, with each team playing offense and defense alternately.

10. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

11. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

12. Les régimes alimentaires restrictifs et les comportements alimentaires obsessionnels peuvent nuire à la santé mentale.

13. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

14. Ang pagmamalabis sa pagkain ng matataba at malasa ay maaaring magdulot ng problema sa kalusugan.

15. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

16. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

17. The team is working together smoothly, and so far so good.

18. Nanlalamig, nanginginig na ako.

19. Muli ay nakabawi ang ekonomiya ng Pilipinas matapos buksan ang turismo sa iba't ibang panig ng bansa.

20. También trabajó como arquitecto y diseñó varias estructuras importantes en Italia.

21. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

22. Sa bukirin, naglipana ang mga tanim ng mais.

23. La música es una parte importante de la

24. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

25. Las hojas de otoño son muy bonitas en la ciudad.

26. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

27. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

28. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

29. Si te gusta la comida picante, prueba el guacamole con jalapeño.

30. Ikinagagalak naming anyayahan kayo sa aming kasal.

31. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

32. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

33. Oo, malapit na ako.

34. Magdamagan silang nagtrabaho sa call center.

35. Limitations can be a source of motivation to push oneself to achieve more.

36. Malilimutin siya sa mga pangalan ng tao kaya’t lagi siyang nahihiya sa pakikisalamuha.

37. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

38. Les préparatifs du mariage sont en cours.

39. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

40. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

41. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

42. The artist painted a series of landscapes inspired by her travels.

43. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

44. Gising ka pa?! parang nabigla nyang sabi.

45. Ang pag-ikot ng mga isyu at pagkukubli ng mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

46. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

47. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

48. Pakibigay ng lakas ng loob ang bawat isa upang magpatuloy sa buhay.

49. Bago ka lumusong, siguraduhin mong hindi ka malalunod.

50. Ang pagkikita at pag-uusap sa isang propesyonal na tagapayo o therapist ay nakagagamot sa aking emosyonal na kalagayan.

Recent Searches

electorallegacynaiinitangabingcapitalsuccessfuljosemorenabilao1920shiningilasingeroexamparagraphssystematisktakesshowsabrilmenosmuchasmuldatibugtonganimobokchoiceagareferspasankitangfatyancebuaudio-visuallymainitconectanilanauditpaafloorisacondosafeclientestiyahimtrueabsnaroonreallymaratingallowedfouraggressionapppointmaputigeneratedeffectthirdtablewithoutfuturereynainiisipbakaordertamisterminoma-buhaygayundinmabutiinasikasoestilosunconventionalpayongmaibibigaytinanongpanitikan,nakikini-kinitaeskuwelahankakuwentuhancultivonanghihinamadmakapangyarihannakakatawamakikiraannakakagalingnagtuturonapapalibutanmwuaaahhmakabilimahawaanopgaver,namumulotnakahigangnalalabisaraadverselytinikkatamtamansaturdaynagpapaypaybinatiwritehitapagsisisiaktibistamumuntingyoutube,investingpollutionpasensiyanakatindigmakaraani-rechargepagkabiglaibinibigaymontrealmaanghangbrancher,hayaangtv-showsmarurumimateryalesnakahainmarasiganumagawmagdaraosmiyerkulestumikimbestidahabitssalaminnationaltungonatitiyakmagkabilangflexibletignanpalamutipaulit-ulitgiyerakagubatanmaghaponregulering,pigilanpabilibefolkningensteamshipsgubatjeepneypinalambotestadosriegapananakitisinalaysaykababalaghangebidensyahihigitsarongwantpalitantagakawardhinabolatensyontransportationestatelipadmanghulisumasakitmeroniyonbinasaathenafe-facebookarkilaphilippinemalapitantulangpigingmayamangpinagkasundotibigcapacidadmgayumabanglatestklimacommissionfireworksmallbusyangnambingbingoutlinedumaandalagangkumukulo