Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "fans"

1. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

2. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

3. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

4. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

5. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

6. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

7. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

Random Sentences

1. We need to optimize our website for mobile devices to improve user experience.

2. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

3. Nag-reply na ako sa email mo sakin.

4. Nasa kuwarto po siya. Sino po sila?

5. Sige. Heto na ang jeepney ko.

6. El que espera, desespera.

7. Obvious. tawa nanaman sya ng tawa.

8. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

9. Cutting corners might save time now, but it will cause problems down the line.

10. Nagsmile siya sa akin, Bilib ka na ba sa akin?

11. Nangagsibili kami ng mga damit.

12. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

13. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

14. May naghubad na ng damit at isinampay na lamang sa balikat.

15. Sama ako. inulit nya lang ang sinabi nya.

16. Algunas heridas, como las provocadas por mordeduras de animales, pueden requerir de vacunación antirrábica o tratamiento contra el tétanos.

17. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

18. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

19. Natandaan niya ang mga panunuksong iyon.

20. Knowledge is power.

21. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

22. Nakatira ako sa San Juan Village.

23. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

24. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

27. Bless you.. tugon ko sa biglang pagbahing nya.

28. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

29. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

30. Sa gitna ng kaguluhan, hindi niya mapigilang maging tulala.

31. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

32. Musk was born in South Africa and later became a citizen of the United States and Canada.

33. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

34. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

35. The basketball court is divided into two halves, with each team playing offense and defense alternately.

36. Ang poot ang nagpapahirap sa aking isipan at pumupukaw sa aking mga kilos.

37. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

38. La prévention est une approche importante pour maintenir une bonne santé et éviter les maladies.

39. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

40. Till the sun is in the sky.

41. Napakaganda ng mga pasyalan sa bansang Japan.

42. However, there are also concerns about the impact of the telephone on society

43. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

44. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

45. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

46. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

47. Después de la lluvia, el sol sale y el cielo se ve más claro.

48. Aanhin ko 'to?! naiiritang tanong ko.

49. Kaya't pinabayaan na lang niya ang kanyang anak.

50. Ang yaman naman nila.

Recent Searches

stonehamfansbeintelaylaygandateachmuchasagaabonomasdansulinganjoybulsaauditchamberscommunicationadvancedmabutingwriteduloipinalutogoingdeclareregularmentepotentialneeddebatestelevisedcheckstoolstabingvideos,maibabalikisinamaakmangbagongpagiisipalas-dosintyaincoughingnanoodtanggalintaong-bayanmataaspublicationhinogopotoothbrushjackzscientistngpuntadalawadinilightsallowedtiposwaitpatrickadaptabilitylumiwanagthingsmagpaliwanagmasayahinnapaiyakmalulungkotcorporationkaniyananigasbobotoarabiapatimaghihintayhumalonagkantahantawaannikasumimangotinventadopakisabidomingomagtipidincidencecolorsumabogtaun-taonpalikuranpagebitiwanbuwalluispasanskillinuulcerpalipat-lipatnaninirahannagmakaawalabing-siyamnamulatbestfriendpagdudugokusinerokasintahanyakapinnakataasmakukulaypaanopanalangininterests,jejuedukasyongawainbopolspakilagaypaki-drawingnilinistilingayoncalidadkubyertosdatimemorialdiaperbillcigarettehongpasokumiinitdevelopedfuncionardulakilongkamiassalbahengpanindahalu-haloseguridadmahiyaunti-untingdamdaminpromotingfeelingeksenaheienchantedadventmuchosbinabaanmataposhinihintaynasagutanmahuhulipumayagkaarawan,mahirapmaghahabinogensindematigasadditionally,salitangkumbentolalakekuwebamatitigassamfundseenatanggapwestpartylawsanimoycompostelaikinatatakotnakakapagpatibaypagluluksaenfermedades,magkaibigannagpakitanakapapasongpatutunguhanikinabubuhaynakaramdambilihinnaturalpagkabuhaynapakasipagalas-diyesnakatirapagtiisanmagbibiyahepantalongtinakasandiscipliner,businessesmagpakasalkare-karepaglakiisadesign,gatoltinikling