Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "business,"

1. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

2. By refusing to compromise, she ended up burning bridges with her business partner.

3. Elon Musk is a billionaire entrepreneur and business magnate.

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

6. He used credit from the bank to start his own business.

7. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

8. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

9. Musk has been described as a visionary and a disruptor in the business world.

10. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

11. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

12. Starting a business during an economic downturn is often seen as risky.

13. The ad might say "free," but there's no such thing as a free lunch in the business world.

14. The business started to gain momentum after a successful marketing campaign.

15. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

2. Women's rights movements have fought for gender equality and greater opportunities for women.

3. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

4. Marami silang pananim.

5. Ang panaghoy ng kanilang awit ay nagbigay-inspirasyon sa mga tagapakinig.

6. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

7. Pede bang dito ka na lang sa tabi ko matulog?

8. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

9. Hindi siya maarte sa kanyang damit, ngunit sa kanyang mga aksyon ay makikita mo ang kanyang kahalagahan.

10. Oh ano na? Hindi ka na sumagot?

11. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

12. Pakibigay ng lakas ng loob ang bawat isa upang magpatuloy sa buhay.

13. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

14. Haha! Bad mood na bad mood ka ah?

15. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

16. Marahil ay kailangan mong magdagdag ng oras sa pag-eensayo upang makamit ang iyong layunin.

17. Inflation kann auch durch politische Instabilität verursacht werden.

18. Hindi lahat puwede pumunta bukas.

19. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

20. Gaano ka kadalas uminom ng bitamina?

21. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

22. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

23. Nag smile siya sa akin tapos tumango.

24. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

25. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

26. Nahihilo ako dahil masyadong mainit ngayon.

27. Nasaan si Mira noong Pebrero?

28. Stop beating around the bush and tell me what's really going on.

29. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

30. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Emphasis is often used to highlight important information or ideas.

33. She has been tutoring students for years.

34. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

35. The momentum of the train caused it to derail when it hit a curve too quickly.

36. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

37. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

38. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

39. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

40. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

41. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

42. Sino ang nakasuot ng asul na polo?

43. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

44. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

45. Nasa Canada si Trina sa Mayo.

46. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

47. Binilhan ko ng kurbata ang tatay ko.

48. Nag silbing inspirasyon si Andres Bonifacio laban sa mga inaapi.

49. Agad na nagliwanag ang kangitan at may sumibol na punong-kahoy sa ibabaw ng nagibang kweba.

50. The Great Wall of China is an impressive wonder of engineering and history.

Recent Searches

pagodinakyatspareomgbusiness,00amsalarinmerrysabermerchandisebuwanresultginoobookmoviesmaniwalabayadtools,akmaconvertidasbarrierstenreservedfelttonbumahawatchingsystemtoothbrushpagkapitasmakapagpahingamaghihintaygjortpagka-maktolriseartistainventedhardjokepshgreatlaromainstreamimpactedcontinuedisla4thibababinabanagtatakadidingmaabotnagtrabahotripmasakitsumasambajuegosmagpahabababayaranmasanaybinatangtumababarcelonanatalobelievedisugaposterprivatekingbulsapalayanhandesdeforcesbiglanakapagngangalitmaalwangbook:kaniyangkundipiecespangetmakagawalikespinangalanangsetyembreandoycallerricacomplexcuriousgeneratedmemoryplacemonitorilingalignsdulastopkabangisanpoliticsnabighaniumuwipalaisipansumamanakatitigcompostelagamitpagnanasaalikabukinpakukuluanauthormagkaibapagsusulitdisenyorosellepanggatongsumasakaymagkaibigandropshipping,pakakatandaanhalikaspanamulatpinagkakaguluhanincidencelakinghukaylearningkagabinakikini-kinitamang-aawitpalibhasaestablisimyentogranikinagalitmabuhaymalalimuugod-ugodvitaminrangemightmongmedidajustbilhindalawamputumingalasang-ayonnagliliyabmetroaletherapeuticsdialledpollutionipanghampasitinuturomournedmasterpalawannanaiglasapambahayhalinglingmalabotoretekumakainnutrientesstrugglednakagagamotbatalanmatikmanpaligsahankabighalangkaypagpasokfestivalesapelyidopag-aanibulalasproducebecomepag-alagaingatanlargoulingtumakasencuestasbumangonfriedaanginaasahangmagpahingacomunesadangkapwanunokassingulangstorymakawala