Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "business,"

1. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

2. By refusing to compromise, she ended up burning bridges with her business partner.

3. Elon Musk is a billionaire entrepreneur and business magnate.

4. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

5. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

6. He used credit from the bank to start his own business.

7. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

8. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

9. Musk has been described as a visionary and a disruptor in the business world.

10. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

11. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

12. Starting a business during an economic downturn is often seen as risky.

13. The ad might say "free," but there's no such thing as a free lunch in the business world.

14. The business started to gain momentum after a successful marketing campaign.

15. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

Random Sentences

1. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

2. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

3. I received a lot of gifts on my birthday.

4. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

5. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

6. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

7. Parang nahulaan ng kanyang ina ang kanyang iniisip.

8. Two heads are better than one.

9. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

10. Superman possesses incredible strength and the ability to fly.

11. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

12. Ang laki-laki ng cardigan na ito.

13. Mahilig sya manood ng mga tutorials sa youtube.

14. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

15. Nakita kita sa isang magasin.

16. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

17. Recycling and reducing waste are important ways to protect the environment and conserve resources.

18. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

19. Anong klaseng kuwarto ang gusto niya?

20. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

21. Al elegir un powerbank, es importante considerar la capacidad de la batería, el tamaño y la compatibilidad con los dispositivos que se cargarán.

22. El conflicto entre los dos países produjo tensiones en toda la región.

23. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

24. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

25. Ang mga punong kahoy ay nagbibigay ng magandang lilim sa takip-silim.

26. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

27. Ang hina ng signal ng wifi.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. All these years, I have been striving to be the best version of myself.

30. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

31. Ano ang binibili namin sa Vasques?

32. Bumibili si Consuelo ng T-shirt.

33. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

34. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

35. A wife can be a source of emotional and physical intimacy for her husband.

36. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

37. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

38. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

39. The company's financial statement showed an increase in acquired assets.

40. Beauty is in the eye of the beholder.

41. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

42. Ayaw mo pa ba? tanong niya na nagpakunot sa noo ko.

43. O sige na nga, diba magkababata kayo ni Lory?

44. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

45. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

46. These films helped to introduce martial arts to a global audience and made Lee a household name

47. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

48. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

49. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

50. Yan ang panalangin ko.

Recent Searches

adverseelitebusiness,usokayhidingnagkikitaprogressvisualstringgeneratedlasingjunjunbitbitdifferentdulohapasinshouldextrasquatter2001iniisipmathkulottatawagansumaraprailjerryadverselyvotespitakasumindifridayperlashorttagaytaypayabonobatidisappointsumasakaynaghubadkaharianairportpaaaddressmatandaexperienceschessfonocoat18thmagbungacompartenhumanosumiilingbilisgreenmagkasakitmarahaspaki-translatenapapasayanagdalamartianasignaturanunbalitamananaogsinungalingsocialetransportationkargabranchesmagalanglagingbumotogrowthhinatidmatitigasmariaandresmamanhikanaddingdoongalakpagnanasaginhawakasaysayankalongbalatmodernepropensorefabrilwereanak-pawiskatandaanpasensyabookdilawnakalilipasfloorinumingamessumayasupremetoretekagandaallowingotraspulalalakenggustingpinakamahabadenbulsadreamsmabutingyearibabapracticadooverdancenangangalitmachinesaplicaimulatvetoexpertsmilemakakibopagkainiskumakantamasasayaguitarranakakamitpakakatandaanuugod-ugodlumakinaiilaganinjuryaplicacionesmontrealnandayaihahatidrenombresalamangkeropodcasts,nagmamaktolpare-parehokinatatakutanikinagagalaknakakitanalulungkotnamumuongnanghahapdigobernadormataasfarmkarwahengnagmamadalinegosyantepagtataposumiiyakpinakabatangmaglalaromagpalibret-shirtnaka-smirknagpaalamhitsurapagtiisannabalitaanpatutunguhantuyongminabutitransmitidasdialledkare-karebabenaibibigaypresence,magagawayumabongmensajespagkabuhayiwinasiwasdahan-dahanselebrasyonnakatapatpinagmamasdanmahawaandisenyongmiranangangaralnapapansinmagbaliklumalaonpagbabayadapatnapu