Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "progress"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Lack of progress or slow progress towards a goal can also be a source of frustration.

3. She has made a lot of progress.

4. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

Random Sentences

1. Nakasuot siya ng damit na pambahay.

2. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

3. Ang lahat ng problema.

4. Nasa ilalim ng silya ang payong ko.

5. Ano ang inireseta ng doktor mo sa iyo?

6. El agua potable es fundamental para mantenernos hidratados y saludables.

7. Ang poot ay nagpapalabo sa aking pananaw at nangunguna sa aking pag-iisip.

8. Omelettes are quick and easy to prepare, making them a convenient meal option.

9. Sa takip-silim, mas maganda ang kulay ng langit dahil sa kakaibang mga kulay.

10. Las labradoras son perros muy curiosos y siempre están explorando su entorno.

11. Ang pagtanggi sa mga ebidensya ay nagpapakita ng pagiging bulag sa katotohanan.

12. El arte puede ser interpretado de diferentes maneras por diferentes personas.

13. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

14. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

15. Oh gosh, you're such an ambisyosang frog!

16. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

17. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

18. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

19. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

20. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

21. Naglalaro siya ng video game nang biglang nabigla sa biglang pag-apoy ng computer.

22. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

23. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

24. Natawa kami sa inasta ni Sara dahil para siyang bata.

25. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

26. Fødslen er en af ​​de mest transformative oplevelser i livet.

27. El nacimiento de un bebé es motivo de alegría y celebración.

28. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

29. The stock market can provide opportunities for diversifying investment portfolios.

30. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

31. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

32. Twinkle, twinkle, all the night.

33. Scissors should be handled with care to avoid injuries and kept out of reach of children.

34. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

35. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

36. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

37. Madami talagang pulitiko ang kurakot.

38. Nang magkasalpukan ang dalawang sasakyan, aksidente niyang naipit ang kanyang kamay sa pinto.

39. Bakit ho, saan ninyo ko dadalhin?

40. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

41. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

42. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

43. Ang pagguhit ay isang paraan upang mag-relax at magpakalma.

44. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

45. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

46. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

47. Omelettes are a popular choice for those following a low-carb or high-protein diet.

48. La música alta está llamando la atención de los vecinos.

49. Ang dalawang isinumpa ay namuhay sa kakahuyan.

50. Teka anong ginagawa niyo dito? 9 na ha!

Recent Searches

progressplatformsplatformsiyangmakikipag-duetoputolninatotoomagpalagohaponcivilizationnegosyanteenviarkauntingmayindividualsnitohimnapakatalinospeechmatagumpaydispositivoskahitdapatvetomahagwaymuliunosnag-oorasyonsantosverynahuhumalingtheretv-showsmalambingpumatolevilhabanaghihikabfeltmarahileffectsakongpagtuturofastfoodsangkapspilllumakadquarantinepinakamagalingmarahasgonefacultysumapitgustodiedpagkaangatbiglaviolencekahapontulisandiinendeligsutillanggardengrowthdali-dalingsamahanultimatelykaraokelibomatulunginsalamangkerofilipinotaot-isanagsibilihojasulonglegislationtasanakatuontuladipinalutoinalumapadgenematatalinomalungkotnabighaninakabibingingmakuhaadditionally,kinauupuangisaangsalitangnagpapaigibnogensindefluiditynandunnakatiratinanggalmay-arirangeinterviewingpsssnakikini-kinitahandaanestudyantemapagkalingaejecutardugodatapwatkapeteryanakabasagpalipat-lipathinilaguerrerosalitamangangalakalincludingkelangantataaspagsubokmagaling-galingprogramssteerbagyopinilitfuepanatagtoymahalinkasalukuyantambayanconditionginawaransandalingpambatangcosechaproductividadcoincidenceadverselytawadcryptocurrencynakaramdamlawslittlecongressenfermedades,paanansorepinapakiramdamantinyfakemagisipkinakaliglignagbibigayviewskalabanparkhalamananlupasatisfactioncanteendidnanghingipintopandemyatinapaylakingidollipadhanapbuhayforskelmundominerviemanualkamaconcernsvehiclesmayumingbulaklakna-fundmamimilibernardohelecellphonepasaheroarbejderbodanewsgupitpinalayasinatupagbusiness,makakabalikpage