Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "progress"

1. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

2. Lack of progress or slow progress towards a goal can also be a source of frustration.

3. She has made a lot of progress.

4. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

Random Sentences

1. Malaki ang kama sa kuwarto ni Olivia.

2. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

3. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

4. Wag ka nang malumbay dahil nandito naman ako.

5. Hindi niya naiilagan ang dagok ni Ogor.

6. Natagpuan niya ang singsing matapos niyang salatin ang ilalim ng sofa.

7. Sino ang pupunta sa bahay ni Marilou?

8. Ano ang kulay ng paalis nang bus?

9. They are not building a sandcastle on the beach this summer.

10. May bago ka na namang cellphone.

11. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

12. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

13. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

14. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

15. La santé des femmes est souvent différente de celle des hommes et nécessite une attention particulière.

16. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

17. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

18. Ang talambuhay ni Juan Ponce Enrile ay nagpapakita ng kanyang malawak na karanasan sa pulitika at pamumuno.

19. Magkano ang bili mo sa saging?

20. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

21. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

22.

23. Technology has also had a significant impact on the way we work

24. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

25. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

26. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

27. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

28. Kinuskos niya ang kanyang buhok at nabasa pati ang kanyang anit.

29. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

30. Einstein was a pacifist and spoke out against war and violence throughout his life.

31. Natitiyak ho ba ninyong talaga na siya ang dumukot ng inyong pitaka? tanong ng pulis kay Aling Marta

32. El curry tiene un sabor picante y aromático que me encanta.

33. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

34. Limitations can be physical, mental, emotional, financial, or social.

35. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. A couple of dogs were barking in the distance.

38. Itinago ko ang mga sulat para sa inyo.

39. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

40.

41. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

42. La obra de arte abstracto en la galería tiene una belleza sublime que despierta la imaginación.

43. The pneumonia vaccine is recommended for those over the age of 65.

44. Ginamot sya ng albularyo.

45. Si prince charming yan noh? pang-aasar ko.

46. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

47. Hindi malinis ang tubig na iyan, bumili ka ng iba.

48. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

49. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

50. Natuto siyang lumaban sa kaniyang mga magulang.

Recent Searches

androiderrors,progressrangevisualleadsequecontinueaffectwaitcuandotopicitemsclientegapedit:eitherbetweensupportheftydedicationmasterlargelearnfallaoverallmagkaparehospiritualnagtatampoinihandabehindmaongdatapuwacultivapaglalaitsistemasaplicacionespaglakipaanongpuntahanestasyonpangaraprosariolazadajuanumakyatpasigawmaidtambayanokaybansangdipanglandelinemalabomajormoodnamanghapalayanmobileworkingnamuhayyumabongnagkasunogkailanmaniniwanumigibcasamakapag-uwinalalabiitinaasbarangaysiponaboeffort,magkasinggandailangkumalmadistanciafansnakatawagkumantasportspinalakingpulangsugatangnilayuanpartembricosnagpepekefrogisinalaysaynagdarasaldowncreditkahilingansinekahapontradehabangkamiaspitakabeginningssaymerlindahealthierkadalagahangpare-parehopinagtagponagliliwanagnagagandahannapakatagalnanghihinamadmagsalitamagkikitamaipantawid-gutomberkeleypaghuhugastsaapaghangajaysonsponsorships,pwedengmakalaglag-pantynangagsibilikabibireserbasyonandrescapacidadnaglaonknightiniirogpakistantungkolmahabolnatutuwabakith-hoykuwentoresignationsaidedukasyonkahitmatitigaskasakitmanlalakbayexperiencespyestatumangobranchhancosechasmaestrodulotgreennagsamaproblemabaduysangadesdefeelpagkasabioutpostbugtongcoaching:patuloyarmeddogperfectdigitalparatinglumipatkataganutsnilolokotumaggappunong-kahoycomunicarsebukakamatandaspreadwatawatandrebumangonkalayaanumokayprobinsyahalu-halopagkatakotdressinilalabasbakuranbumalingvitaminkasamafotostinaposhahatolseniormakatawa