Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "especializadas"

1. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

Random Sentences

1. The sports center offers a variety of activities, from swimming to tennis.

2. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

3. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

4. Ang gusto sana namin ay dalawang double beds.

5. Mathematics can be used to optimize processes and improve efficiency.

6. She wakes up early every morning to exercise because she believes the early bird gets the worm.

7. Anong kulay ang gusto ni Merlinda?

8. Women make up roughly half of the world's population.

9. Climbing without proper equipment is incredibly risky and dangerous.

10. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

11. Adequate fiber intake can help regulate the digestive system and maintain gut health.

12. La letra de una canción puede tener un gran impacto en la audiencia.

13. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

14. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

15. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

16. Cheap sunglasses like these are a dime a dozen.

17. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

18. Walang mangyayari satin kung hindi tayo kikilos.

19. Naglalaba si Maria ng mga damit tuwing Linggo para sa buong pamilya.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Ano ang mga apelyido ng mga lola mo?

22. Les employeurs offrent des formations pour améliorer les compétences des travailleurs.

23. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

24. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

25. Sa Tokyo Olympics 2020, napanalunan ni Hidilyn Diaz ang gintong medalya sa weightlifting.

26. Wag kang mag-alala.

27. Emphasis is an important tool in public speaking and effective communication.

28. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

29. Es importante leer las etiquetas de los alimentos para entender los ingredientes y la información nutricional.

30. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

31. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

32. Puwedeng dalhin ng kaibigan ko ang radyo.

33. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

34. They do not eat meat.

35. The model on the runway was a beautiful lady who effortlessly commanded attention.

36. Nahantad ang mukha ni Ogor.

37. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

38. Scientific evidence has revealed the harmful effects of smoking on health.

39. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

40. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

41. Siya ay kilala sa kanyang magalang na pag-uugali kahit sa mga hindi niya kakilala.

42. Limitations can be financial, such as a lack of resources to pursue education or travel.

43. I am absolutely certain that I locked the door before leaving.

44. Masaya akong pumasok sa silid-aralan dahil mahilig ako sa pag-aaral.

45. Sadyang kaunti lamang ang alam kong mga lenggwahe.

46. La paciencia es una virtud que nos ayuda a ser mejores personas.

47. I have a craving for a piece of cake with a cup of coffee.

48. Tumayo siya tapos humarap sa akin.

49. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

50. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

Recent Searches

saranggolaespecializadasrenombremaramotlorinakapaligidkapatawarankinabubuhaynakauwipinagbigyaninintaynakapagsabitiniradoralikabukinmagbasamatigasaraw-arawaktibistaisulatnasasabihanlahatisinagottaga-ochandopuntahanbinitiwanbarreraskapataganpagsagotasignaturamakukulaysampaguitakoreamagtanimkilaykambingkutsilyonahulognapilitangcardlilikopinilitmabangoproudhastatulalaipinamiliambagubosangflaviokikovenusiyoomgnumerosasdreamhusojustiyongclientspanaymaestrokaindelebasahanbabaealitaptapconsideredpakialaminsteadcertaininuminbayaranlockdowndingginputifacecontentpinilingimpitnakalabaspaglakiiglapsunud-sunuranmaalwangtelevisedeconomicinitissuessambitkagayaebidensyanakarinigmatatalinokittumalonpangalaniyanmaliksifullahhhhnakikitanapadpadwinskargangnasabroadcastpanghabambuhaynakalipaspagkuwanag-iyakanpodcasts,agaw-buhaytingmagkaparehonagpakitanapuyatmahihirapnakuhamatapobrenginaabutankinumutanprodujomagagawamawawalanakapikitmatangumpaypinipilittirangnakilalakinagabihanmedisinahinihintayautomatisksistemasnaglokohanadvancedeterminasyonmabaitlalakewhateverumagagjortkayoangkopwastekinsecarmenmaidtsescottishinantayiilandulotreboundpalapiteffektivnatigilangpinisilmakitapaskongpaghuhugasfireworkscomunestonwestbriefanimoycalleratentospecialnagbungaboxtabasiosnaggingnegosyoromanticismoencounterpalayanmapaikotadvancedsalapiipinalutoclientemotorpagka-diwatabawaaeroplanes-allmalapalasyowaldolifenagliliyabtumatawadlayuanpornobodysenadorpapelpumunta