Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "cross"

1. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

2. Alam mo ba kung bakit takot si Cross sa hospital?

3. Alam mo ba kung nasaan si Cross?

4. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

5. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

6. Ginising ko si Cross, Oy gising. Umaga na.

7. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

8. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

9. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

Random Sentences

1. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

2. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

3. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

4. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

5. I don't have time for you to beat around the bush. Just give me the facts.

6. Tak kenal maka tak sayang.

7. Hanggang mahulog ang tala.

8. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

9. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

10. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

11. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

12. Hindi makapaniwala ang lahat.

13. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

14. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

15. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

16. Gaano ka kadalas pumunta sa doktor?

17. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

18. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

19. Musk has faced controversy over his management style and behavior on social media.

20. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

21. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

22. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

23. He is taking a walk in the park.

24. The website's content is engaging and informative, making it a great resource for users.

25. Ang lahat ng taong napapadaan sa nasabing puno'y napapahinto dahil sa dami ng bungang nakasabit sa mga sanga.

26. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

27. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

28. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

29. Las vacaciones son una época para compartir regalos y mostrar gratitud.

30. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

31. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

32. Microscopes are also used in materials science and engineering to study the microstructure of materials.

33. International cooperation is necessary for addressing global environmental challenges, such as climate change.

34. Nang tayo'y pinagtagpo.

35. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

36. He missed his flight and then his luggage got lost. That just added insult to injury.

37. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

38. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

39. Pano ba yan.. wala ng magkakagusto sa akin kasi mahina ako..

40. Nagkalat ang mga adik sa kanto.

41. Think about what message you want to convey, who your target audience is, and what makes your book unique

42. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

43. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

44. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

45. Ang agila ang pambansang ibon ng Pilipinas.

46. Patuloy ang labanan buong araw.

47. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

48. Many people think they can write a book, but good writers are not a dime a dozen.

49. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

50. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

Recent Searches

crossmalalimgraphicsangasisidlanmissionamericanmatipunoscottishbotomartesfamemakabalikhubad-baroinakalaitakpinilibinabalikoutpostcongressvideonaturalarghchambersgrabefistsscheduletabasleejeromecompartenknowledgeerrors,ingatanhusaynasawimagalingmgakisamepagdukwangkargahanhawaknahihiyangmarinigpinipilitumokaybayanibinaonnagsisilbikasamamalungkottunaydogmalilimutinminamahalillegalsasagutinnagbibirobalitalalakianthonylaganapnakakatabakapalknight10thmatamananahipakealamnaghinalaflaviopoong1929paghakbangskyldesadvancedgymkahulugankinagalitanbisikletalatecigarettesmamarilnungkindleechavekahariandyipniparaangpaglalayagtabing-dagathumpaykapangyarihanbestfriendbaduyfulfillingalituntuningalakkahitnayonkaniyangpakakasalanna-fundkayabangannaglokonagplaymanaloemocionessocialesnagpuyosnakakagalapanghabambuhaynamulaklakkamaopapanigkasamaanmagbibiyahenagtitiisnagkakatipun-tiponsagotpaki-ulitkanikanilangpaciencianagpakunotsangkaptulisanfactoresnatatawabalediktoryanestudiobayaningmalilimutanmahigitaustraliadealnakukuhalosssinapelikulamatulunginexperience,institucionesbigyanbateryapaskongbumotoparurusahaninihandaamingadvancenatulogpagputitusindvissalbaheibaswimmingsapagkatstyrelakadbagkus,constantlyinabotsubalitmeaningpalagimedidapancitsinimulanrelyandamingbecomecontent,numerosaskantomelissapakpakputahematangpingganscientificsamedatacontinuesgeneratecomunesfinishedstrengthmaduromagtatagalparacornerdietcreationmucheksamseenpositionerdoble-karastyrerwould