Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "form"

1. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

2. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

3. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

4. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

5. Instagram has introduced IGTV, a long-form video platform, allowing users to upload and watch longer videos.

6. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

7. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

8. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

9. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

10. Television also allowed for the creation of a new form of entertainment, the television show

11. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

12. The website's contact page has a form that users can fill out to get in touch with the team.

13. TikTok is a social media platform that allows users to create and share short-form videos.

Random Sentences

1. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

2. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

3. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

4. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

5. La brisa movía las hojas de los árboles en el parque.

6. Les comportements à risque tels que la consommation

7. Ang dating kawawang usa a naging isang napakagandang diwata subalit hindi na rin natago ang mga sugat nito.

8. Tumango siya tapos dumiretso na sa kwarto niya.

9. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

10. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

11. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

12. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

13. Ang mga biktima ng paggamit ng droga ay dapat bigyan ng tulong upang maibalik ang kanilang kalusugan at makabalik sa normal na buhay.

14. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

15. Kung may tiyaga, may nilaga.

16.

17. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

18. ¿Te gusta el sabor picante del jengibre?

19. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

20. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

21. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

22. Natapos ko ang malaking proyekto na matagal ko nang inaayos kaya masayang-masaya ako ngayon.

23. Ang mga palaisipan ay maaaring magpakita ng mga patlang sa kaalaman at kasanayan ng isang indibidwal.

24. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

25. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

26. We sang "happy birthday" to my nephew over video chat.

27. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

28. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

29. Iniuwi ni Rabona ang pusang iyon.

30. Kanino ka nagpagawa ng cake sa birthday mo?

31. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

32. Anong tara na?! Hindi pa tapos ang palabas.

33. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

34. Einstein's legacy continues to inspire scientists and thinkers around the world.

35. Gusto ko na po mamanhikan bukas.

36. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

37. Sa kaibuturan ng kanyang kaluluwa, alam niyang tama ang kanyang mga desisyon.

38. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. Hindi ibig sabihin na kuripot ang isang tao ay madamot na ito.

41. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

42. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

43. Emphasis can be used to create a memorable and impactful message.

44. May dalawang kotse sina Dolly at Joe.

45. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

46. However, there are also concerns about the impact of the telephone on society

47. Anong oras ako dapat umalis ng bahay?

48. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

49. At minamadali kong himayin itong bulak.

50. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

Similar Words

informationinformedformsplatformsformaformasinformaciperformanceFormatplatform

Recent Searches

formkakayananstateduonmabibingiyoutube,panghihiyangmusicorasannanlakilarangantuvonagsmilelaki-lakipiyanonilaosalagangfeeliguhitnapagodmagpa-picturenananaginipmeetprincetulalamaliitbagamasumayatuluy-tuloynakipagcanadangayonhinanakitbangbankkonsultasyonbestfriendbagkusbusabusinroonpapaanonakatigilmeriendagumuglongmalakinovellesnagpepekestotuluyantinulak-tulakkinahuhumalingannakatunghayparaangbritishbarrierssahodmagtatakahastasilanatayopatismallmalapadlunestelevisedyelomakakaattentionmakikinigipanlinisforcesmagisingmamarilmundonagpapaitimpyestaballadversepagpanhikhahatolnakaangatmagsabiexcitedkarapatangcondotabierlindasalarinhumakbangpamburafollowednakapangasawakategori,publicationsummithampasnegroslitokahongnaglipanangconsiderednagtatrabaho18thkwebatokyoislandtools,sumapitsaktanprobinsyaltodisfrutarngpuntanagbentainuminusejoshuaideapatricksaranggolanabitawanbestidanatitirangpamanhikankusinerolarawanpasensiyamagtanghalianlaylayparangpagkaawabiglaaninfusionesnangangahoykamoteumaagosmaaaringbagsakpagpapakalatkristopaghabatrentaislanakapasanilapitanmagsasakalabanresponsiblemanatiligabinggrammarnaglutocalambanaggalanapapatinginmagsunogmalamigexpertisenasiyahanpigilankuwartopinangalananenglandhitikmabangonobodybarangaymariomagpapabunotdraybersobragenerabapagpasensyahan11pmsinunud-ssunodlungkotkapangyahiranutak-biyapagpapasanlungsodipinatawagaktibistatumatakbopagtataassabadolikurankilongkamaliannahigakalakionlypaguutosbinibiniiniinommagawamarahilsiyangmasasayaskyldesvisual