Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "instead"

1. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

2. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

5. I hate it when people beat around the bush instead of just getting to the point.

6. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

7. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

8. The store offers a store credit for returns instead of a cash refund.

Random Sentences

1. Omelettes are a popular choice for those following a low-carb or high-protein diet.

2. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

3. Nag-umpisa ang paligsahan.

4. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

5. The heavy traffic on the highway delayed my trip by an hour.

6. Maganda ang mga alaala ko dito sa Pilipinas.

7. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

8. Si Ogor ang kanyang natingala.

9. Sa gitna ng pagkabigo, nagpalabas ako ng malalim na himutok upang maibsan ang sakit sa puso ko.

10. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

11. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

12. The team's performance was absolutely outstanding.

13. Ang paggamit ng droga ay hindi lamang masama sa katawan, kundi pati na rin sa isipan.

14. It is an important component of the global financial system and economy.

15. Diyan ang bahay ni Mr. Marasigan.

16. Bakasyon ko na sa susunod na buwan.

17. Sa computer nya ginawa ang disensyo ng kanyang invitation.

18. Ein Bild sagt mehr als tausend Worte.

19. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

20. Maaliwalas ang langit ngayong umaga kaya masarap maglakad-lakad.

21. Debemos enfrentar la realidad y no ignorarla.

22. Hindi ako makahinga nang maayos kaya nanghina ako at nag-halinghing nang malalim.

23. Hindi magandang magpakita ng pagmamalabis sa pagkakain sa mga simpleng pagtitipon.

24. Wie geht's? - How's it going?

25. Sa tingin mo ba may balak ako? he grins.

26. Sorry hindi kita nasundo. apologetic na sabi si Maico.

27. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

28. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

29. **You've got one text message**

30. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

31. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

32. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

33. Mayroon kaming bahay sa Tagaytay.

34. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

35. El ajedrez es un pasatiempo que disfruto desde niño.

36. La película que produjo el estudio fue un gran éxito internacional.

37. Na parang may tumulak.

38. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

39. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

40. Hindi naman sa ganun. Kaya lang kasi...

41. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

42. Medarbejdere kan blive tildelt forskellige arbejdstider, som natarbejde.

43. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

44. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

45. Miguel Ángel es conocido por sus esculturas, pinturas y arquitectura.

46. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

47. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

48. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

49. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

50. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

Recent Searches

insteadbehaviorgitanascurrentcertainableaffectkasinghighestlikodkalayaanprosperlangochandokantoforskel,magwawalanagkasunogo-onlinepagbigyanformajingjingpang-araw-arawmasaktanbumotonakapanghihinapingganbasahinwestganoonstrengthresearch:recentlystyrerbreakgusalinapadpadroofstockniyancommercialcaraballotagumpaytiniklingnutrientesnuongreenworrystrategyvedeeeehhhhabomalapadabalabernardopostcardipanlinisveryroommabilisreservesgamitinabsoffentligipongeducationalbarateredpapuntafeelingtagaloghila-agawannakapagreklamonakapangasawapagkakayakapnanlilimahidnakakapamasyalnamumulaklaknagtatrabahoejecutansakristannapapatungonagpalalimmahahanayeconomykinakabahankikitalosmuliguerrerosigpangangatawanmahinangpamilihanisulatkabundukannaulinigankalalaroonlynagdabogpananglawnakahugengkantadangmakauwisistemastaglagasmagdoorbellmaisusuotmakasalananglumakifitnesshandaanmapaikotempresascardigantumitigilaga-agapundidobasketbolnaliligobarrerassukatinikatlongbahagyasementeryohinamaktinanggalnagpasamagustongmaramotmauntognababalottrabahojolibeekamotesisipainlilikodissepanitikan,galitkasuutantuvocarolpagkaingminamasdansalatindiseasesiconsmagkasinggandadumaanfrescoconsumemeansmejolumilingonbuwanbotostatessnaflavioindianagdarasallintablueslungkotimpactocomputerhapasinformsreallycontrolledrawwindowpasinghalgawingsapotautomatiseremaawadawboklugarpokernalalabingtanawinsumasayawbituinnatagalanmumurabroadsidohinintaypinalakingtsinelaspagpanhikintelligenceipaliwanagligayalibagmuchosdinanas