Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "hurtigere"

1. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

Random Sentences

1. Palibhasa hindi niya kasi malaman kung mahahanay ba siya na isang mabangis na hayop o di kaya'y ibon.

2. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

3. Tinapos ko ang isang season sa netflix kaya napuyat ako.

4. She admires the bravery of activists who fight for social justice.

5. Lazada is an e-commerce platform that operates in Southeast Asia.

6. Magandang Umaga!

7. Ito ay alay nila bilang pasasalamat kay Bathala.

8.

9. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

10. A portion of the company's profits is allocated for charitable activities every year.

11. ¿Qué música te gusta?

12. Nakikisalo siya sa pamilya at totoong nasisiyahan siya.

13. From its early days as a technology for the elite, to its current status as a staple in most

14. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

15. Les travailleurs peuvent participer à des programmes de mentorat pour améliorer leurs compétences.

16. Omelettes are a popular choice for those following a low-carb or high-protein diet.

17.

18. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

19. The grocery store offers a variety of fresh produce, including fruits and vegetables.

20. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

21. The United States has been involved in many international conflicts, including World War I and World War II.

22. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

23. A successful father-child relationship often requires communication, patience, and understanding.

24. Beauty is in the eye of the beholder.

25. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

26. Tila nagiging mas mahirap ang hamon habang tumatagal.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. Drømme kan være en kilde til inspiration og kreativitet.

29. The cough syrup helped to alleviate the symptoms of pneumonia.

30. Mabait ang mga kapitbahay niya.

31. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

32. Limitations can be financial, such as a lack of resources to pursue education or travel.

33. Ako nga pala si Nicolas, kinagagalak kitang makilala.

34. Transkønnede personer kan opleve udfordringer i forhold til sundhedspleje og adgang til passende behandling.

35. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

36. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

37. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

38. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

39. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

40. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

41. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

42. Hinde naman ako galit eh.

43. Sa di-kawasa ay dumating ang malungkot na sandali.

44. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

45. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

46. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

47. Mataas sa calcium ang gatas at keso.

48. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

49. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

50. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

Recent Searches

tungkodhurtigeremagtatanimhawaiidistanciapaghalikjuegossalbahengengkantadangnami-missconocidossangalabiskailanmankristosamantalangpinansinnalugodnaglaonkapitbahaynapansinlandaspisaragusalibarcelonahumihingiattorneynobodytanghalimanakbosurveysannikainfusioneskapalallemandirigmangbiyernesninanapadpadtirangpesosdumilimorganizematigasngisikasuutanlihimmusicianstagakreynanapapatinginaminpssskindsfitinatakeanihinautomationherramientakatapatcompositoreshmmmbutchnapatingingodtkahilinganmeanssumuotnahihilodibamaibalike-explainpalaygrammarlotsawasinumangmansanaslikespakilutotinitirhannaggalaarbejderneahousekapetradevehiclessolargraphiclintawerenapahintocivilizationpopcornfuelilangpopularizemenoskwebagabingbarrocohehepitakaouemoodroonhydelbatiburgerditoprimerrelolordbitawanuminomviewsstudiedaddauthorlikelydahonibabadragoninitvisualsourceyeahcompleteextrashouldnerissaboxcommunicatehardinculturahila-agawanhihigamakikitamessagetinangkabluesmaalikabokparehongmagnakawlimahansetyembrebosstagalsellsanggoltamarawnakakunot-noongayawmakatipalakamagsasakanahintakutanpaglulutobinabaratmagsusuotmerchandisemisteryomaghahandasapilitangentryjohnpag-uugalikasalukuyangpaki-translatenagpuyosambisyosangkaraokekayabangantv-showsmanilawifipatunayanre-reviewginamitotraslaryngitismalaki-lakipulaginisingnagtaposbaku-bakongpyestabumisitabanawesinabimatindinghistoriahabitlayuninmonumentopiecestodaslangyumabang