Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "office"

1. He's always the first one in the office because he believes in the early bird gets the worm.

2. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

3. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

4. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

5. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

6. My co-workers organized a surprise birthday party for me at the office.

7. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

8. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

9. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

10. She has just left the office.

11. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

12. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

Random Sentences

1. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

2. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

3. Gusto ko sanang makabili ng bahay.

4. Mas magaling siya kaysa sa kanya.

5. The store was closed, and therefore we had to come back later.

6. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

7. Tumingin siya sa wrist watch niya saka nag-isip.

8. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

9. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

10. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

11. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

12. Matagumpay akong nakapag-alaga ng mga halaman kaya masayang-masaya ako ngayon.

13. He has fixed the computer.

14. Ang mga magsasaka ay nahihirapan sa kanilang ani dahil sa matinding tagtuyot.

15. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

16. Gawa ang palda sa bansang Hapon.

17. Nakatingin sa araw, humakbang siya upang kunin ang pingga ngunit sa paghakbang na iyon, bigla siyang pinatid ni Ogor.

18. The king's subjects are the people who live in his kingdom and are under his rule.

19. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

20. La técnica de sfumato, que Da Vinci desarrolló, se caracteriza por la suavidad en la transición de los colores.

21. Ikinuwento ng bata sa babae na lason ang mga bungang ito.

22. Muchas personas disfrutan tocando instrumentos musicales como hobby.

23. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

24. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

25. Wag kang tumabi sakin! paguutos nito.

26. Ano ang gagawin mo sa Linggo?

27. Ang bobo naman ito, di pa nasagutan ang tanong.

28. He listens to music while jogging.

29. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

30. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

31. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

32. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

33. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

34. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

35. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

36. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

37. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

38. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

39. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

40. The French omelette is a classic version known for its smooth and silky texture.

41. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

42. Makikita mo sa google ang sagot.

43. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

44. Tulala lang rin yung daddy niya sa amin.

45. May naisip lang kasi ako. sabi niya.

46. We admire the dedication of healthcare workers in the midst of the pandemic.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Sa tuwing may malaking okasyon, ginaganap ang ritwal ng pagtawag sa mga ninuno upang humingi ng gabay.

49. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

50. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

Recent Searches

additionofficeverywideipagamotmesangbumahacriticshearnamestablishcommunicatesolidifygeneratedprogrammingpracticesterminteligentesanotheruniqueanimgoingboxbabebehindupolatestshortpagiisipkaaya-ayangnakiramaywalang-tiyakniyannagtutulunganlabananfloorenergy-coalsugatangnagwo-workpandemyapyestahukaybeginningngayontinikmanmontrealcomputere,uugod-ugodkondisyonhahatolnagkalapitnapagtantonovellesnamasyalinvesting:negro-slavespamamalakadpinakamahalagangmagsasalitanakatinginpumapaligidnapabayaanpalabuy-laboykinabubuhaymagkaibamakahiramnahuhumalingkonsultasyonh-hoykasinggandanakataposnakaka-bwisitpagngitinakatunghaytobaccomakikipag-duetonakaluhodpangungutyamaibibigayintramurosumiibigautomatisknaiiritangcombatirlas,ilalagaypanindagumandaconventionalnagpalutomahiyamakasalanangninanaistv-showssakupinapatnapulumayonagwikangtusongbahagyamanakbomakakabihirariegaemocionaleleksyonanilagownninyongboyfriendtagalmaghatinggabiumigibnapakokailanlunesyamanbinatilyopalapagasiadiaperpiratananaypromotehimayinpublishing,plagasbinanggafatherwalletmalamangsigloautomationcharismatickarapatanpaksamedyolinawkayabiyernescelularesibonmayabangapoyinantaysamakatwidganamaaariguhitpinatidnagdaramdamcivilizationwalisreloresortipaliwanagbiglangsumugodayudagalitbarrierssoreherundermurangbotemapakaliencountergoddaanmapuputisteveenchantedbyggetkulisapfullpowerseksenanutrientesperfectpasswordputolinfluencecountlessknowdifferentscaleclientemitigateimpactedconstitutionbeyondpinamumunuanbitbitadaptabilitysystemrefuloautomaticulingharap-harapangdanmark