Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "restaurant"

1. Have you been to the new restaurant in town?

2. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

3. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

4. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

5. Nagtatrabaho ako sa Manila Restaurant.

6. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

7. The chef is cooking in the restaurant kitchen.

8. The chef is not cooking in the restaurant kitchen tonight.

9. The new restaurant in town is absolutely worth trying.

10. The restaurant bill came out to a hefty sum.

11. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

12. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

13. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

14. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

15. The restaurant was full, and therefore we had to wait for a table.

Random Sentences

1. Limitations can be physical, mental, emotional, financial, or social.

2. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

3. Hindi pa rin siya umaalis sa kinauupuang balde.

4. Limitations can be addressed through education, advocacy, and policy changes.

5. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

6. Huwag na sana siyang bumalik.

7. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

8. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

9. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

10. Sampai jumpa nanti. - See you later.

11. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

12. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

13. Kakutis ni Kano ang iba pa niyang kapatid.

14. Good. Pahinga ka na. Dream of me. aniya.

15. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

18. Ngumiti lang sya, I know everything, Reah Rodriguez.

19. Humahaba rin ang kaniyang buhok.

20. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

21. He was known for his active and controversial presence on social media, particularly Twitter.

22. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

23. La crisis económica produjo una gran inflación que afectó a los precios.

24. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

25. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

26. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

27. Dumating ang mga atleta sa entablado nang limahan.

28. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

29. Football is known for its intense rivalries and passionate fan culture.

30. Ang kulay ng langit sa takipsilim ay parang obra maestra.

31. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

32. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

33. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

34. Gagawa ako ng tsaa pagkatapos kong kumain.

35. Hinikayat ang mga turista na lumibot sa mga nakakaakit na tanawin ng naturang isla.

36. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

37. Hinagud-hagod niya ang mga kamao.

38. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

39. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

40. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

41. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

42. Eh? Kelan yun? wala akong maalala, memory gap.

43. Hindi lahat ng ating mga pangarap ay madaling makamit, kaya't kailangan nating magpakatatag.

44. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

45. Marahil ay maulan bukas kaya't dapat magdala ng payong.

46. A couple of songs from the 80s played on the radio.

47. May klase ako tuwing Lunes at Miyerkules.

48. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

49. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

50. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

Recent Searches

kananthanklilyrestaurantabrilisaacproductionmodernesuccessfulfar-reachingboracaybiglaarguefionamatchingritwalsellcongresssinipangparagraphsclientsmodernpinyaallottedpaskongkinainaeroplanes-allmapaikothinugotavailablekaringsusunduinbuwalmatangflexibletrafficresearch:comeoperatecommunicationskumarimotmillionsisabalecoatpookespadadaddy4thstrategymulti-billionconventionalsumalaipasokoffernuclearthroughouteksaytedt-shirtpapuntatuwangpetercakeinspiredjunioumilingbreakpinalakinghalagabeingnagniningningbetaimprovedissuescontentlearnthemhimigcrazytiyapotentialattackincludegitarasequetipinteractipinalutospreadeditornanghihinagayunmannasasakupanhumahangosmakikipagbabagmagbibiladbumibitiwmakapalagunonagtaposnaglutopagbibiropaliparinbiglaantamarawsahodsocietybagamalilipadbisitadiyanmahinaawitintataasidiomagabinapapikitbestidamapahamakairconcoaltawananbinigayxixtillprovestillibalikforcesmulicankarnabalpollutionballasoshouldappmataaasformdebatesculturasundhedspleje,kayang-kayangtuladpinakidalapalancamahahaliktravelkanikanilangnaabutannaghuhumindiguugud-ugodnagliwanagbalitasidonagulatmakakatakasmagtatagalnapaplastikannagtitiisnakapagngangalitnakakapamasyaldahan-dahannagawangbiologipaglalabadapamilyangkagandahannaguguluhangkaaya-ayangsabadongngumingisidyipnipaghuhugasmalulungkotlumamangkwartoactualidadmalapalasyoairportcellphonehabangkumampigiyerakapintasangnai-dialfactoresnag-emailkatutubomanahimiknawalapalasyoginawangjosiekainitanhonestopagguhitipinauutangmahabangpinauwi