Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "fascinating"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

3. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

4. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

5. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

6. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

7. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

8. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

9. Hun er en fascinerende dame. (She is a fascinating lady.)

10. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

11. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

Random Sentences

1. At være transkønnet kan være en udfordrende, men også en berigende oplevelse, da det kan hjælpe en person med at forstå sig selv og verden på en dybere måde.

2. Oh gosh. Inintay pa sya ng prince, what does it mean?

3. Illegal drug traffic across the border has been a major concern for law enforcement.

4. She decorated the cake with colorful sprinkles and frosting.

5. ¿Qué fecha es hoy?

6. Gaano ka kadalas uminom ng bitamina?

7. Mabilis na lumipad ang paniki palabas ng kweba.

8. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

9. Hoy akin yan! inagaw nya pabalik yung popcorn.

10. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

11. El ajedrez es un pasatiempo que disfruto desde niño.

12. Les jeux peuvent également dépendre de la chance, de la compétence ou d'une combinaison des deux.

13. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

14. Einstein's ideas challenged long-held assumptions about the nature of space and time.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Investing can be a long-term strategy for building wealth and achieving financial goals.

17. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

18. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

19.

20. The platform has also been criticized for promoting harmful content and contributing to online bullying.

21. Nami-miss ko na ang Pilipinas.

22. George Washington was the first president of the United States and served from 1789 to 1797.

23. The restaurant was full, and therefore we had to wait for a table.

24. A mi esposa le encanta hacer manualidades como pasatiempo.

25. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

26. Pinamunuan niya ang mga Pilipino laban sa mga Espanyol at kalaunan sa mga Amerikano.

27. Ang mga magsasaka ay nagtatanim ng palay.

28. Lumiwanag ang silangan sa pagsikat ng araw.

29. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

30. Walang makakibo sa mga agwador.

31. The platform has implemented features to combat cyberbullying and promote a positive online environment.

32. Binigyan niya ng kendi ang bata.

33. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

34. Las redes sociales son una parte fundamental de la cultura digital actual.

35. El nacimiento es el momento en que un bebé sale del útero de la madre.

36. You're stronger than this, pull yourself together and fight through the tough times.

37. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

38. The sun sets in the evening.

39. Has she met the new manager?

40. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

41. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

42. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

43. Sweetness can be used to mask other flavors and create a more palatable taste.

44. Pumasok ang mga estudyante sa klase nang limahan.

45. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

46. I bought myself a gift for my birthday this year.

47. Hindi mo maaasahan si Ryan sa mga simpleng utos dahil sa pagiging malilimutin niya.

48. Sana ay masilip.

49. Ano ang ininom nila ng asawa niya?

50. Umalis siya kamakalawa ng umaga.

Recent Searches

restfascinatingtirangenforcingpersonsipinasarilingbarbubongmatabaatasalapiefficientevolveableclassmatereturnedstructurepilingwebsiteinvolvebehalfautomatiskannavillagebertonaglalabaconclusion,nakagawianpreviouslydifferenttinaasanpabilidinhalospabalikpiyanomakipag-barkadakagandamanilbihandahilmagpahabamakakabalikmagkabilangadditionally,kakilalamilyongsiyudadmagsaingpagkalungkotexplainradiobienlockdownsagingvirksomheder,kuwebasuelopinakamagalingkungkalakihannaglipanangpinapataposyumabongfragumagamitmahalagalumiwagpamahalaanisinagotnapilitangpanaydayshelpedtrespacenanditohumanodelesurgeryinteligentesnutsworkdaydiseasesfacecertainprocesskomunikasyonnaglalakadmadilimsugatangnaabotbasketbolcanteendiyaryopaninigaskumampitinataluntonnananaginipmagkakagustonabalitaanpagpapatubonagkakakainnagliliwanagmakikipag-duetopasukannakapagngangalitkategori,spreadpamimilhingnagawangtaun-taonnakuhangnahuhumalinggagawinhitsuralunetadiwatanananalongpinagawatatayopaglapastanganpagmamanehonagagamithayaangpagsahodkidkirankayabanganhoneymoonnalalabinglumutangculturasintramurostumikimpinangalanangbowlalapaapsenadormakapagempakemagkasakitmanahimiklumilipadabut-abotpagkapitasmarahasmedya-agwaproblemakasiboyfriendmanonoodnagpasanpalayosabongdesign,favorkargangbarangaybutipatientmataaasnagdaosidiomanatuloydissemagbigayansundaecapacidadnoonkayaorganizecubicletseadoptedbingokinseanitonag-replyrevolutionizedshinesbinigayserious1000nagpapaitimbeganiguhitvehiclesbotosparepalagioncewatchspecializedso-calledmuchasdilimnitongbriefgagandapopulationalbularyo