Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "fascinating"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

3. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

4. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

5. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

6. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

7. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

8. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

9. Hun er en fascinerende dame. (She is a fascinating lady.)

10. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

11. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

Random Sentences

1. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

2. Anong oras natatapos ang pulong?

3. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

4. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

5. She is playing the guitar.

6. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

7. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

8. Matumal ang mga paninda ngayong lockdown.

9. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

10. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

11. "Tapos na ang laban, wala nang dapat pang pag-awayan," ani ng punong barangay.

12. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

13. Bago ka lumusong, siguraduhin mong hindi ka malalunod.

14. ¿Dónde está el baño?

15. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

16. Kinabukasan ay nawala si Bereti.

17. Nous allons visiter le Louvre demain.

18. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

19. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

20. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

21. Mabuti na lamang at hindi natuloy ang sumpa.

22. Oo naman. I dont want to disappoint them.

23. She missed several days of work due to pneumonia and needed to rest at home.

24. The team won a series of games, securing their spot in the playoffs.

25. Pwede bang sumigaw?

26. I have been studying English for two hours.

27. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

28. Tienes que tener paciencia para lograr buenos resultados.

29. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

30. Ano ang isinulat ninyo sa card?

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

33. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

34. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

35. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

36. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

37. Anong klaseng sinigang ang gusto mo?

38. Ang bunga ng kakaibang halaman at tila ba kamay na nag-iimbita.

39. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

40. Seperti katak dalam tempurung.

41. Alin ang telepono ng kaibigan mo?

42. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

43. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

44. She admires her mentor's leadership skills and work ethic.

45. Mahina ang tulo ng tubig sa kanilang pook.

46. Walang sinuman ang nangahas na kontrahin ang plano ng kanilang lider.

47. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

48. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

49. The invention of the telephone led to the creation of the first radio dramas and comedies

50. Musk's companies have been recognized for their innovation and sustainability efforts.

Recent Searches

umiyakfascinatingmetodiskkasingginaganoonablemanirahansakopechave3hrsneedsnothingilocosnicopagpapakalatmahusaytransmitidassakitkatibayangcuidado,furtsismosanaghihinagpismasarapmahalinkenjiabigaeltinamaananumangstylesbumuganagbibigayanpanaysanggoldisappointlayout,pag-aapuhapmangingibiganimnapasubsobexcusetokyomakalingnakasakitrolledpansinrailwaysnilagangnilapitumpongsanadakilangsumasambasarapnagbabakasyonreserbasyonhealthierautomaticpangyayarikamatiskumatoknatinfaceminamahalinulitharmfulstudylabananhamakayawmahihirapmag-ingatrelyshouldpelikulahinugotsikiplasingeropaskopersonalsumapitwarimagkakapatidnagtatanongdonetalinoemphasisgathernadamamabangojejumakaratingsakadiyanpapayakutodnamilipitmaliksidinikahirapankakuwentuhanalexanderviewkaliwaipipilithitdependkasamaaneducationaddressalanganchangekumapitzoomkakutisreducedreboundlorenauniqueunderholdertinitindanagbabalamisacaracterizaemocionalgubatpagbabagong-anyomalasutlacasesheinasasabihanipinabalikinirapankamisetangyounyangresearch,dilawkatagadyipnihimayintiemposawitinrodonaniyonpinangalananpasasaanconsistkumulogduonbutikipanindapapuntangpadalaskaloobangnakaupopresidentialhuertolandbibisitatuwasiponjacky---schoolshelenafreedomsnamataynapakatagalsellingnewssuwailconstitutionpnilitbangkonakagawianpagsasalitaeclipxenaritomaabutaninspirationkaramihanpaki-ulitlarongkatabingwalangsuriinalagangatacynthianasuklammagsugalnaglulutodecisionssuzettepamanpublishing,playsbrindarkatapatkalye