Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "fascinating"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

3. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

4. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

5. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

6. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

7. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

8. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

9. Hun er en fascinerende dame. (She is a fascinating lady.)

10. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

11. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

Random Sentences

1. Hindi madaling mahuli ang mailap na pag-asa.

2. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

3. I know they're offering free samples, but there's no such thing as a free lunch.

4. Ang palay ay hindi bumubukadkad kung walang alon.

5. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

6. Ang dalawang isinumpa ay namuhay sa kakahuyan.

7. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

8. Walang bagay na di makita at agad tinatanong ang kanyang ina.

9. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

10. Puwede ba sumakay ng taksi doon?

11. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

12. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

13. Time heals all wounds.

14. The conference brings together a variety of professionals from different industries.

15. Catch some z's

16. Einstein was a member of the NAACP and spoke out against racism in the United States.

17. Pedro at Juan ang mga pangalan namin.

18. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

19. The company's losses were due to the actions of a culprit who had been stealing supplies.

20. Mabuti na lamang at nandyan ang kanyang kaibigan.

21. Ahh... haha. Umiling na lang ako bilang sagot.

22. The culprit responsible for the car accident was found to be driving under the influence.

23. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

24. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

25. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

26. Pagkatapos ng ilang araw, nagbunga ng isang pulang prutas ang puno.

27. The children are playing with their toys.

28. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

29. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

30. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

31. Kung walang tiyaga, walang nilaga.

32. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Kumanan kayo po sa Masaya street.

35. Wala siyang sapat na budget, samakatuwid, hindi niya mabibili ang gustong cellphone.

36. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

37. The credit card statement showed unauthorized charges, so I reported it to the bank.

38. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

39. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

40. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

41. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

42. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

43. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

44. Ang pagmamalabis sa paggamit ng mga plastik na bag ay nagdudulot ng environmental pollution.

45. Hinde naman ako galit eh.

46. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

47. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

48. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

49. They have studied English for five years.

50. Binili ni Rita ang damit sa tindahan.

Recent Searches

fascinatingpublishingagekamakalawabetweenclockfacultynamungaventabinabajunioschoolyondejamapaibabawbigascuentasinabidecreasedtelevisedbabanagbabalasusikayonangyaripangungusapmasasayatumatanglawpaghaharutandistansyamakalaglag-pantynangangahoynapakatagalnagtagisannagliliwanagnakakatulongbloggers,t-shirtkalayaankwenta-kwentatobaccopagsambakakataposmaghahatidmagkakaroonstrategiestatayopaki-bukasitinaasvitaminhiramtagpiangpatakbongcompaniesnakabluebutikipaparusahanyouthnapuyatflamencoprobinsyasakop3hrskatulongputaheadecuadonoongsantosmatesanatitirasabognawalaltohverkuyariyaniyongraphicresignationlegendswashingtonhetotablepumupuntalibertynagpakilalasteveellawordsreservationeraphitborntripmapakalipasangsiguradopinsanpaslitmakuhacomunicarsereallytsinacallingreadmenureleasedfredreadingsecarseetopaskopinagbigyancarlonyasatisfactionsarilinatininakalasparenagpapaigibmag-amanagmamaktoldagatbuongnaniniwalaiyongpagpapasannakatitigparoroonabinibilangpare-parehoboracaybusogblazingbigotetransmitssalelumalakiikinamataykomunikasyonkakuwentuhanexcitedcultivaagam-agampaglalaithubad-baroselebrasyonnaghuhumindigeskuwelanamumulotnag-angatsulyapihahatiddiretsahangisasabadhiwatinulunganmanilbihanthanksgivingkaramihantitadesisyonansay,nagpasamabefolkningenkaliwanagbagoisinamanauntogdescargarpumikitnaawamatalimkaraniwangpangalananisipanfollowedtinitindamaongpamankakayanangsalesbecamekumatoklipadkasaysayannogensindepagekelanapoyplasalenguajejenatoothbrushbarnesmaluwangpierpartyhinihiling