Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "peace"

1. A lot of noise from the construction site disturbed our peace and quiet.

2. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

3. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

4. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

5. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

6. Peace na tayo ha? nakangiting sabi niya saken.

Random Sentences

1. Kapag ang tao ay may tiyaga, kahit maliit na bagay ay may tagumpay.

2. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

3. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

4. All these years, I have been surrounded by people who believe in me.

5. Paki-charge sa credit card ko.

6. Rendang adalah masakan daging yang dimasak dalam bumbu khas Indonesia yang kaya rasa.

7. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

8. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

9. Napakaseloso mo naman.

10. She has been cooking dinner for two hours.

11. I'm so sorry. di makaling sabi niya habang nakatitig dun.

12. Pakiluto mo nga ng pancit ang mga bata.

13. Ang aming angkan ay may natatanging kultura at mga paniniwala.

14. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Wie geht's? - How's it going?

17. Biglang nagtinginan sila kay Kenji.

18. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

19. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

20. El actor hizo un comentario controversial que está llamando la atención de los medios.

21. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

22. Crush kita alam mo ba?

23. Selvstændige medarbejdere arbejder ofte på egen hånd.

24. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

25. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

26. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

27. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

28. May klase ako tuwing Lunes at Miyerkules.

29. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

30. Para lang ihanda yung sarili ko.

31. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

32. Magtanim ka nga ng mga puno dyan sa garden.

33. Pero bigla na lang siyang hindi nagpakita.

34. Ang hudyat ay isang senyales o tanda na nagbibigay impormasyon o nagpapahayag ng isang ideya o kaisipan.

35. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

36. I baked a delicious chocolate cake for my friend's birthday.

37. Nasan ka ba talaga?

38. Hindi malaman kung saan nagsuot.

39. Saan itinatag ang La Liga Filipina?

40. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

41. Magandang Gabi!

42. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

43. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

44. Det er vigtigt at huske heltenes bedrifter og lære af dem.

45. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

46. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

47. Mula nuon, sa gubat namuhay ang mga matsing.

48. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

49. Samahan mo muna ako kahit saglit.

50. Amazon started as an online bookstore, but it has since expanded into other areas.

Recent Searches

abalapeacelandodangerous00ammeaningvehiclesmaarisaladisyembremaliitislalorenamapadali1973trippedebalepasangchavitsakinsumakitreservationjackyinternetfredumilingflyboxetopracticadofaryonhatingcigarettelastinglibrenangyariputingdedicationattackevolvedgotgenerabauniquemasterpracticesseparationreadingpagkaimpaktobutikibatok---kaylamigcandidatesbasatatlotalasugatannami-missbeenmakakibofundrisebatang-batavantanawingenegayundinideologiesbusstudentkulotbulaobstaclesmagbagong-anyocomputere2001yatakinakabahannanlalamigpagkalitomaligayaso-calledtagalogsumayahimselfthemhitiknag-iisiptayomalumbaycellphonegamotkawili-wilisanawaripinunitinaaminhanapbuhaypinaghatidanbritishritwalnakayukolalabasmaynilana-suwaykatagalanmarmaingparaangmamarilspasedentarywalngredigeringeffektivbitiwanyepiguhitdulotremaincenterwalongoperahanparosamakatwidadangalexandertaong-bayanmobilesumuboandroidvisualbadingformsimplengandybeyondsambitprogressconsideraidbabaplanviewseviljoyhapag-kainanreserbasyonnananaginipnagbiyayapagkamanghanapakahusaynagpakitatubig-ulanpagsasalitanakaririmarimmanggagalingpalabuy-laboynauponagsagawagulatmahiwaganglabing-siyamhinawakanclubmagpaliwanagnagandahankinikilalanglumiwanagmadurasmabangoattorneypshkagipitanmaliwanagsundalohulukanikanilangpagkagustoibinililumakasmaisusuotdekorasyonpinagkiskisbefolkningen,negro-slavespagtangisnapipilitanlansanganindustriyagumigisingnakilalaamuyinkaramihaninagawhumalomanirahanfactoreshulihantaostv-showslumayo