Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "website"

1. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

2. I can't access the website because it's blocked by my firewall.

3. I discovered a new online game on a gaming website that I've been playing for hours.

4. I found a great recipe on a cooking website that I can't wait to try.

5. I just launched my new website, and I'm excited to see how it performs.

6. I like how the website has a blog section where users can read about various topics.

7. Maganda ang website na ginawa ni Michael.

8. Online traffic to the website increased significantly after the promotional campaign.

9. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

10. She is designing a new website.

11. She is not designing a new website this week.

12. The website has a chatbot feature that allows customers to get immediate assistance.

13. The website has a lot of useful information for people interested in learning about history.

14. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

15. The website is currently down for maintenance, but it will be back up soon.

16. The website's analytics show that the majority of its users are located in North America.

17. The website's contact page has a form that users can fill out to get in touch with the team.

18. The website's content is engaging and informative, making it a great resource for users.

19. The website's design is sleek and modern, making it visually appealing to users.

20. The website's loading speed is fast, which improves user experience and reduces bounce rates.

21. The website's online store has a great selection of products at affordable prices.

22. The website's search function is very effective, making it easy to find the information you need.

23. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

24. The website's social media buttons make it easy for users to share content on their social networks.

25. The website's user interface is very user-friendly and easy to navigate.

26. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

27. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

28. We need to optimize our website for mobile devices to improve user experience.

Random Sentences

1. TikTok has become a popular platform for influencers and content creators to build their audience.

2. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

3. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

4. Omelettes can be enjoyed plain or topped with salsa, sour cream, or hot sauce for added flavor.

5. Sweetness can be used to mask other flavors and create a more palatable taste.

6. Pumunta si Trina sa New York sa Abril.

7. Some limitations can be temporary, while others may be permanent.

8. She studies hard for her exams.

9. Espero que te recuperes pronto, cuídate mucho y sigue las indicaciones del médico.

10. Bigyan mo ng pera ang pulubi.

11. Ginagamit ang "ani" bilang pamalit sa "sabi ni" kapag inilalahad ang sinabi ng isang tao sa isang usapan o kuwento.

12. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

13. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

14. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

15. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

16. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

17. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

18. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

19. Paliparin ang kamalayan.

20. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

21. Anong kulay ang gusto ni Merlinda?

22. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

23. Landet er et godt eksempel på, hvordan man kan skabe en velfungerende

24. Sige ako na ang isa pang sinungaling! Bwahahahahaha

25. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

26. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

27. We have finished our shopping.

28. Sa mga lugar na mabundok, naglipana ang mga halaman na katangi-tangi sa kanilang ganda.

29. Masyadong mahal ang pagkain sa hotel.

30. Utak biya ang tawag sa mahina ang pag iisip

31. Bawal ang maingay sa library.

32. Television is one of the many wonders of modern science and technology.

33. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

34. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

35. All these years, I have been discovering who I am and who I want to be.

36. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

37. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

38. The United States is a federal republic, meaning that power is divided between the national government and the individual states

39. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

40. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

41. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

42. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

43. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

44. Sa isang linggo ay pupunta kami sa Singapore.

45. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

46. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

47. The feeling of frustration can lead to stress and negative emotions.

48. Mahalaga rin ang pagkakaroon ng kooperasyon at pagtutulungan upang malutas ang mga palaisipan sa isang grupo o komunidad.

49. Bagsak ang ekonomiya ng Pilipinas matapos ang nangyaring kaguluhan.

50. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

Recent Searches

websitesambitpagdiriwangpaceinsteadmakaangalfoundoperativosbungadma-buhaylumitawkailanmanbriefmanlalakbaytatanggapinnagtatanongpanindangmakawalamartianbibilibulamaranasankapangyarihangipagtimplapagkaimpaktopresleybayaninahigitanatagiliranikinalulungkotsourcebarnestumirasmokerumilingpalapagkasamaanmanahimikuusapanabialapaappinahalatahumbleviskaaya-ayangpagbabayadvitaminbabaerotelefongurobumahayunkapalnakapasokumigibnaglalabawalispahahanapnabuoeffektivtinaabotgawansakenpresenceforskeljudicialnanakawangoodeveninginutusanhistorybeyondtiemposeksport,magkaibanagawangpangyayaribuntismagbubunganakainbarroconakapagngangalitnakakatulongarghpumitasrobinhoodnaispulongbluesinasadyaorganizekayagreatlypriestutilizannaalalacharitableleohatingfeedback,sabogstoplightculpritcirclengamassachusettsvehiclesmarilouhuertokaratulangagwadorcentermarketplacesnakalipaspetarkilabarcelonabangkonanoodnamumutlamagbantayinteresthetotitaleveragena-fundrabbabeen2001plankumantacigarettepaglapastangankinalimutankristoomgpinagsasabiadvancednapapatinginrelevantnaggalamahalagadeterminasyonpaghingiipapahingamagkakagustolikasbukamakapaibabawlumakaspropesorstrategiesandreredigeringawitpakipuntahanpangulobeganinalokhydelmagandangdemocracyvaliosainyongkasapirinsetschildrenpag-ibigbinatilyoapologeticitemsmainitbalangkumpletonuclearinterestsbulongpaggawaremainpinagkiskisalokpaghahabilalamunancomenapakatalinoself-publishing,dreamsnapipilitanharpcreativesuotpedeeviljackybinabamasasalubongtoretekumembut-kembotnaantigbisikletakinuha