Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "website"

1. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

2. I can't access the website because it's blocked by my firewall.

3. I discovered a new online game on a gaming website that I've been playing for hours.

4. I found a great recipe on a cooking website that I can't wait to try.

5. I just launched my new website, and I'm excited to see how it performs.

6. I like how the website has a blog section where users can read about various topics.

7. Maganda ang website na ginawa ni Michael.

8. Online traffic to the website increased significantly after the promotional campaign.

9. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

10. She is designing a new website.

11. She is not designing a new website this week.

12. The website has a chatbot feature that allows customers to get immediate assistance.

13. The website has a lot of useful information for people interested in learning about history.

14. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

15. The website is currently down for maintenance, but it will be back up soon.

16. The website's analytics show that the majority of its users are located in North America.

17. The website's contact page has a form that users can fill out to get in touch with the team.

18. The website's content is engaging and informative, making it a great resource for users.

19. The website's design is sleek and modern, making it visually appealing to users.

20. The website's loading speed is fast, which improves user experience and reduces bounce rates.

21. The website's online store has a great selection of products at affordable prices.

22. The website's search function is very effective, making it easy to find the information you need.

23. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

24. The website's social media buttons make it easy for users to share content on their social networks.

25. The website's user interface is very user-friendly and easy to navigate.

26. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

27. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

28. We need to optimize our website for mobile devices to improve user experience.

Random Sentences

1. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

2. Iyon ang totoo, sinasabi niya sa sarili.

3. Sudah makan? - Have you eaten yet?

4. Hindi ko kayang itago ito, gusto kong malaman mo na sana pwede ba kitang mahalin?

5. Nag-iisa kasing anak si Ranay.

6. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

7. She loved to travel, and therefore spent most of her savings on trips.

8. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

9. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

10. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

11. Siya ang aking kaulayaw sa lahat ng bagay.

12. Frohe Weihnachten! - Merry Christmas!

13. Sama-sama. - You're welcome.

14. Software er også en vigtig del af teknologi

15. Ano ang pangalan mo? ang tanong niya sa bata.

16. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

17. Nationalism can be a source of conflict between different groups within a nation-state.

18.

19. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

20. Confocal microscopes use laser technology to create 3D images of small structures.

21. A lot of money was donated to the charity, making a significant impact.

22. Some couples choose to have a destination wedding in a different country or location.

23. Inakalang totoong kaibigan ang kasama niya, pero pinagsisinungalingan siya.

24. Kakain ako ng spaghetti mamayang gabi.

25. Pakanta-kanta si Maria habang nagtatrabaho.

26. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

27. I don't like to make a big deal about my birthday.

28. Dahil sa pag pupursigi, maganda ang naging resulta ng exam ni Marie.

29. Hindi dapat basta-basta magpautang ng pera dahil ito ay maaaring magdulot ng problema sa kahuli-hulihan.

30. A picture is worth 1000 words

31. Ang digmaan ay maaaring magdulot ng pagkasira ng mga kultura at tradisyon.

32. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

33. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

34. Kinakailangang kahit papaano'y makapag-uwi siya ng ulam sa pananghalian.

35. Nakangiti siya at ang babae ay ngumiti rin.

36. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

37. The chef is not cooking in the restaurant kitchen tonight.

38. Nakarating kami sa airport nang maaga.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. Los héroes son ejemplos de liderazgo y generosidad.

41. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

42. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

43. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

44. Cutting corners might save time now, but it will cause problems down the line.

45. The field of entertainment has also been greatly impacted by technology

46. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

47. Bumili si Ryan ng pantalon sa palengke.

48. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

49. Inakyat ng bata ang puno at tinikman ang bunga.

50. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

Recent Searches

websitebuslotindigbagamatooldatapwatnatalongthoughiskokoryentesinkpitumponghinanapsang-ayonmahinasayawanpahingatumindiglaborpaghuhugasbutniya1980magpasalamatmakinangupuaningatanforstånatutulogclassroomioslaruannilulonsupilinnodaga-agatalagasumahodkayoditodapatpilipinaspatakboaleumulannakuhatsismosabenefitsmalawakmarangyangcasamakalaglag-pantynuonmagdoorbellmusmosmaskaranakatinginhalu-halopalikuranyakapinphilosophicalnaninirahanpagtiisanbarung-barongsinasadyabinitiwanipinabaliknakahainmalasutlakomedornatitiranapabayaandangerouscalidadlamangtelangdiligintekstempresastengaanovidenskabtenidopanindanakaluhodactualidadpinagtagporestaurantsponsorships,commissiongagawinnalalabiipinangangakgumisingfurmatabangbelievedpuntahanlegendspapaanoopgaversweetpaketenicopaglakinatigilangasolinamalamangtuladcertainaraw-arawnagpasamamantikamobilespendingnapakasipagcriticsdi-kawasamagtakaiyamothatinggabilegislativejustdisyembrecaraballoperfectbagalpumitasnakakasamagagtagak4thmangingibigmauntogcomunicarsetilitatanggapinhusosalapampagandamedyobuwalbisikletakahulugankongresowidespreadnagbibigayanpinakamaartenggodtsilyadaypuedenmakapalagnagpabotubodrosaresignationmainittwinklenanunuksopasigawthemfidelpisoeyemakipagtagisanwaitsellsinampalunconventionalnakabiladlayout,nagliwanagisinalangintramuroscualquierconcernstambayanbinge-watchingpagtatanimlutosandaliherunderkontratamgaenforcingsyncthirdglobalupworkkakayananjacemagdilimdeterminasyonpandidiriaffectjunjunbayannagkalapittarget