Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "small"

1. A microscope is a device that uses lenses to magnify small objects.

2. Acts of kindness, no matter how small, contribute to a more charitable world.

3. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

4. Confocal microscopes use laser technology to create 3D images of small structures.

5. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

6. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

7. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

8. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

11. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

12. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

13. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

14. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

15. The store has a variety of sizes available, from small to extra-large.

16. Viruses are small, infectious agents that can infect cells and cause diseases.

17. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

Random Sentences

1. Protecting the environment involves preserving natural resources and reducing waste.

2. Tinuro ng aking lola kung paano magluto ng suman gamit ang pulotgata.

3. El amor todo lo puede.

4. Il faut que j'aille faire des courses ce soir.

5. One man, one word ka ba? Ang tipid mong sumagot eh!

6. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

7. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

8. Pagpasok niya sa bahay, nabigla siya sa liwanag na biglang sumulpot.

9. Ang kulay ng langit sa takipsilim ay parang obra maestra.

10. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

11. The car broke down, and therefore we had to call for roadside assistance.

12. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

13. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

14. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

15. Alles Gute! - All the best!

16. Sa brainly ako madalas nakakakuha ng ideya.

17. Mahalaga na magpakatotoo ka sa mga taong bukas palad sa iyo upang mas maintindihan ka nila ng husto.

18. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

19. Bibili rin siya ng garbansos.

20. Magdamag na bukas ang ilaw sa kwarto.

21. Ang pagiging malapit sa kalikasan at paglalakbay sa magagandang lugar ay nakagagamot sa aking kaluluwa at nagbibigay ng kapayapaan.

22. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

23. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

24. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

25. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

26. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

27. Kalahating pulgada ang kapal ng pakete.

28. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

29. Mahusay talaga gumawa ng pelikula ang mga korean.

30. Pinagsulat si Jayson ng pangungusap sa pisara.

31. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

32. Isulat mo ang pangalan mo sa papel.

33. Nakakabawas ng pagkatao ang mga taong laging nagmamangiyak-ngiyak dahil ito ay nagpapakita ng kahinaan sa kanilang karakter.

34. Omelettes are a popular choice for those following a low-carb or high-protein diet.

35. May I know your name so I can properly address you?

36. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

37. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

38. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

39. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

40.

41. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

42. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

43. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

44. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

45. Mabuti pang umiwas.

46. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

47. Sampai jumpa nanti. - See you later.

48. Wag kang tumabi sakin! paguutos nito.

49.

50. Marami ang pumupunta sa Boracay tuwing

Recent Searches

smallworkingpersistent,anotherressourcernenakangisingnagliwanagnagkapilatnagpasamanaghilamosuugud-ugodbusiness:befolkningenhabitsairplaneskakayanangmarielnewspaperssmilematabangkriskaaniyalipadpunong-punokarapatanmakisigmaluwangbruceabihydelsementonakalagayconventionalearlykiniligcrosspacehistoriasnizprogramasequekutisvidtstraktcoachinggalitdustpanmanuscriptnagtutulungannalagutanpanghihiyangnakaririmarimkulunganlandlinebilibidanimo1940niyonkuwadernotakotmaligayadahilpumatolnakangitingcityaddictionparehasmataaspublishing,larawanmessagemunalingidanihincallerkaringsusunduintumaliwasconstitutionhirapviewsospitalstartednag-aalangannagbakasyonsiglaikinatatakotmagkaibigantaramanlalakbaybaduynguniterlindapinapalonagsasagotnagpaalambinibiyayaandiscipliner,airportstrategiesi-rechargemagtatanimperpektingmakaraanmagbantaynasaanasahanpagtayopagkaawatennislever,binatilyonagsilapitlabahinkinalimutankaibanapaluhodrabbasentencemusiciansmonumentosociale1950staposleosamakatwidevilgifthimigspaghettibitawansportsmoviesfrescohistoriakomunikasyonskills,pagkaimpaktokasaganaant-shirtkinakaligligmagpasalamatmagpahabakabutihansabihinmasaholramdamkulturika-12ipinansasahogfreedomstagpiangtanyagnakainbayaninglagaslasmemorialsakopbiyasmaghahandapinilittinapayheartbreaklayawlihimandressinakopskillssenatehanap-buhayinagasbusyavailablegivetargetbotepuntafuncionartrentanakatuwaangbasahanstonehammagbungacellphoneabscolourdogmatangrelevantisinuotdingdingbeforelibronagtatanongsagasaanvideosisinaboykaliwaclassroompresenta