Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "small"

1. A microscope is a device that uses lenses to magnify small objects.

2. Acts of kindness, no matter how small, contribute to a more charitable world.

3. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

4. Confocal microscopes use laser technology to create 3D images of small structures.

5. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

6. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

7. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

8. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

9. I'm on a diet, but I couldn't resist having a small slice of cake.

10. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

11. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

12. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

13. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

14. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

15. The store has a variety of sizes available, from small to extra-large.

16. Viruses are small, infectious agents that can infect cells and cause diseases.

17. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

Random Sentences

1. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

2. Lasingero ang tawag sa taong laging nag-iinom ng alak.

3. Baka nga si Amba pa gumawa ng tela aniya.

4. It is an important component of the global financial system and economy.

5. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

6. Pero sa isang kondisyon, kailangang bayaran mo.

7. Tatanggapin ko po ang anumang kaparusahan.

8. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

9. Malilimutin si Lolo kaya’t lagi niyang hinahanap ang kanyang salamin.

10. I'm on a diet, but I couldn't resist having a small slice of cake.

11. Mahal na mahal kita.. wag mo muna akong iwanan, please.

12. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

13. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

14. Ano-ano pa po ang mga pinaggagagawa ninyo?

15. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

16. They do yoga in the park.

17. Kanino ka nagpatimpla ng cocktail drink?

18. Hinding-hindi napo siya uulit.

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

21.

22. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

23. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

24. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

25. Nag tinda kahapon ang aking ina upang kami ay may makain ngayong araw.

26. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

27. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

28. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

29. Nagluluto si Tess ng spaghetti.

30. Nagpagupit ako sa Eclipxe Salon.

31. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

32. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

33. It is a versatile dish that can be customized with various fillings and toppings.

34. A couple of friends are planning to go to the beach this weekend.

35. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

36. Hindi maiwasan ang naghihinagpis na damdamin ng mga biktima ng kalamidad.

37. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

38. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

39. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

40. Lumaking masayahin si Rabona.

41. Hindi madaling mahuli ang mailap na pag-asa.

42. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

43. Ang mga hayop sa gubat ay naglipana din.

44. Ang mailap na pagkakataon ay kailangan hanapin sa kung saan-saan upang hindi ito masayang.

45. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

46. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

47. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

48. Nakumbinsi niya ang mga ibon at siya ay isinama sa kanilang pagdiriwang.

49. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

50. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

Recent Searches

smallnagpuyosnapakamapuputialas-doselaternegosyantedatingmuysearchkastilanagsasagothalinglingpamumuhayexpresannag-aaral4thavailablemachinespangyayarikommunikerermassachusettsbeyondhvornatagalankaedadlayawtuloypunung-kahoyfilmsnuevamedyosabayabalangnagpa-photocopybinataksandokclosebukapantalongbulakalaknilolokonakapangasawakaalamaninisipmakahihigitbinabaanasongformasnagkasakitmawalawasakpinagkasundomagbabayadpagbubuhatanmournedpagsigawsinalansanyousalitangmininimizerespektivenakinigtirahanopisinaorderinbayaankakayananabenaimposiblekabarkadanagsisigawnababasadroganaaksidentepagngitipiermakatulongmabiropagbigyanamoybumababaoperasyonkinahuhumalingankasoyiniangatinihandapagkakahawakmaarinasaktansigapayilog1928puedensimoninabutanaccuracypag-aalalanagmadalingoncemasukoltumambadlumitawmakasalanangnakauwiipapamananabasacompartenmariangandydadaallottedkalakihanmegettsongtitonamumuokasangkapanpromotingrecordednasamakabilinabagalannakakatakotaniyaparticularmanamis-namisrememberedpaalammay-aripinaliguanstreamingkumantamatabangbuksanmillionskuwartovanencompassesdescargarcomunesanysecarsepantheonnagmartsadrawingnanangisrestawrannewnapakaalatstaplemahahabanapapasayaparipagkakataonmagpapapagodpambatangbanlagsapagkatgraphicuugud-ugodlumakadmesasulatnapakaramingkumikilosadverseintsik-behohalamagagamitmagaling-galingpatunayanhjemstedmakapagmanehopumayagsiniyasatltoeducationalbabaeinatupaghayopnaiinitankakaibalumakingcoatginisingtinangkangpopcornpulahumaniniibigprinttumayolockdownkeepingbabaliktumabakumilosadvancement