Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "another"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

3. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

4. I always feel grateful for another year of life on my birthday.

5. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. spread information and knowledge from one corner of the globe to another.

8. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

9. The stuntman performed a risky jump from one building to another.

10. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. Money can be earned through various means, such as working, investing, and entrepreneurship.

2. Nagsusulat ng pangungusap ang mga estudyante.

3. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

4. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

5. Nasa kumbento si Father Oscar.

6. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

7. Sa harap ng libingan, naghihinagpis ang mga kaibigan at pamilya ng namayapang kaibigan.

8. Robusta beans are cheaper and have a more bitter taste.

9. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

10. Halatang takot na takot na sya.

11. Nagpaluto ako ng spaghetti kay Maria.

12. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

13. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

14. Scientific evidence suggests that global temperatures are rising due to human activity.

15. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

16. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

17. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

18. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

19. A couple of raindrops fell on my face as I walked outside.

20. Umikot ka sa Quezon Memorial Circle.

21. The Grand Canyon is a breathtaking wonder of nature in the United States.

22. Minsan, inaasikaso ko ang mga bagay-bagay ng aking nililigawan upang maramdaman niya ang aking pag-aalaga sa kanya.

23. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

24. Sa takip-silim, mas nakakapag-relax ang mga tao dahil sa kalmado at malumanay na hangin.

25. She helps her mother in the kitchen.

26. Akala ko nung una.

27. Hindi pa ako nakakapunta sa Barcelona.

28. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

29. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

30. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

31. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

32. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

33. El deportista produjo un gran esfuerzo para ganar la competencia.

34. Gusto ko sanang ligawan si Clara.

35. If you think she'll forgive you, you're barking up the wrong tree.

36. La calidad del suelo es un factor clave para el éxito de los agricultores.

37. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

38. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

39. The United States has a complex political system, with multiple levels of government and political parties.

40. Anong kulay ang gusto ni Merlinda?

41. Pagpasok niya sa bahay, nabigla siya sa liwanag na biglang sumulpot.

42. Naku, wala ka naming gagawin sa Davao.

43. Kung wala kang pera umalis ka na dyan at baka hindi ako makapagpigil sa iyo.

44. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

45. Oo naman! Idol ko si spongebob eh.

46. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

47. Kailan niyo naman balak magpakasal?

48. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

49. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

50. Maraming bayani ang nagawa ng mga bagay na imposible sa panahon ng kanilang panahon.

Recent Searches

anothermakasahodculturagayunmanmakapangyarihanflamencohumayocontinuessalatincurtainsboardgathergoodeveninghousematagumpaytonyawitanmartialnamofficementalintroduceginangpag-indakbehindwayssurgerynasusunogumangatpatawarinmismolumindolkabibistaplesabihingpagodaywanbeautytumatanglawnakakatababayawakparaantelephonenaglabananamanmbricosmagsasalitanakakunot-noongartistaskasangkapannagtatampobangladeshdumalawnagpakitalinemakapaibabawpagpapakilalapunung-punokabuntisannagreklamosalekumanannangapatdanpasyentenecesarionaglokosadyangdiapernovemberkundihumigaateathenakahusayansapilitangeneroricoupobigoteganacoaldipanglenguajelarongbateryacarloplagaseasiermarsoreservationtingdrayberressourcerneshetradeyourvampiresmahirapreadingtalefredlightsbringtanghalianetostudenthelpfulmonitorgitanasscaleactivityrelievededitbibiliasthmatanghalitapepagsalakaysanadreamsgalitayawwalonghinatidmakabawimaramingmiranagsisunodtotooreynabawalmagsimulaagadpag-uwileveragenagsuotnagplayngunitnagdaosnagdaanpagsuboknabiglamuntingmatamismasyadomalinismalapitmakamitkarangalanskirtmag-ibamaestramabangolumiwaglumibotlumakaskubyertoslulusogiwasiwasmasayang-masayanglibertycakelabananegenkuwentojoykuwartokurakotkumunotalamkulisapdagatkomedorkinantakatapatkaraokekamukhapakanta-kantanagdadasalkaklasebabesimagesituturonagalitbituinipinakoiniirogingataniiwasanendviderehumingahinukaykinikilalangpanghihiyangkalakihanhapunanhanapinbayaningobservation,granada