Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "another"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

3. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

4. I always feel grateful for another year of life on my birthday.

5. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. spread information and knowledge from one corner of the globe to another.

8. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

9. The stuntman performed a risky jump from one building to another.

10. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

2. Kasi ho, maraming dapat kumpunihin sa bahay.

3. Television has a rich history, and its impact on society is far-reaching and complex

4. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

5. Kawhi Leonard is known for his lockdown defense and has won multiple NBA championships.

6. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

7. Panalangin ko sa habang buhay.

8. Mataba ang lupang taniman dito.

9. Nakikisalo siya sa pamilya at totoong nasisiyahan siya.

10. Hiram lamang natin ang ating buhay sa Diyos.

11. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

12. Cada año, la cosecha de manzanas en esta región es muy buena.

13. Maputi si Kano, kaya ganito ang tawag dito sa kanilang pook.

14. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

15. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

16. Sana makatulong ang na-fund raise natin.

17. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

18. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

19. In this industry, singers who can't write their own songs are a dime a dozen.

20. Omelettes are quick and easy to prepare, making them a convenient meal option.

21. Wie geht es Ihnen? - How are you?

22. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

23. Kapag pumunta ako, may makakawawa.

24. Black Panther is the king of Wakanda and possesses enhanced strength, agility, and a suit made of vibranium.

25. Nag tinda kahapon ang aking ina upang kami ay may makain ngayong araw.

26. This can generate passive income for you, but it does require some capital to get started

27. The business started to gain momentum after a successful marketing campaign.

28. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

29. Mawala ka sa 'king piling.

30. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

31. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

32. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

33. Kapag walang makain ay naghuhukay ng mga gabi, tugi o anumang halamang ugat sina Karing para maipantawid-gutom.

34. The car broke down, and therefore we had to call for roadside assistance.

35. I am exercising at the gym.

36. Está claro que necesitamos más tiempo para completar el proyecto.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

39. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

40. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

41. ¿Quieres que le agregue un poco de picante a tu comida?

42. Puwede ko ba mahiram ang telepono mo?

43. Size 6 ang sukat ng paa ni Elena.

44. Lord, Wag mo muna siyang kunin..

45. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

46. Ang empleyado ay na-suway sa pagsusuot ng hindi tamang uniporme sa opisina.

47. Les sciences de la Terre étudient la composition et les processus de la Terre.

48. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

49. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

50. They served a mouthwatering strawberry shortcake for dessert.

Recent Searches

bitbitanotherstatingreleasedboylimititinuringferrergalitsakaylibrotechnologiesnakuhafacilitatingknowswouldkabilanglalakengannaideyamethodslearningakmangiyoconventionalnamatayamongnagtatakboreferspondonagmamaktoltanganbuwalprogramawatersumisidflereharidikyambaulsparkwealthdolyarkubyertosinuminrepresentativesgrabemanggagalingjackyngayontradekasingthroatbyggetanilahisanumangumiinomestablishedhanapbuhayrepresentativekirbywantberegningerdissekainisasthmaadvancesexamplelazadalayawnararapatcarriesenfermedades,playssinabigrupowakasyeplarongilagayfeedback,paanotatloremotetodaypinagawanananalonghagdanankulungannakikihukaypaki-drawingdispositivonaguguluhandagat-dagatancoincidenceunconventionalenvironmenttinulak-tulakpaglapastanganpinaghandaanmulti-billiondiscipliner,mahiwagawikaculturesisinamabeyondlendhopetayongfollowedmansanasbirotilimeetanak-mahirapinyongmilyongtoothbrushmaliniswelllayuninanofilmmataliktessneedsechavemiramanghuligiverheartbreaksarao-orderofrecennagisingphilosophicalpakisabislavesapilitangtumangotilauugod-ugodmustsemillastrespabalangparkeumaagosnatandaanmagtipidnuhsumasakitmarmaingnaka-smirkwriting,naglipanangmusicianpamburapaki-translatenagre-reviewnagbabakasyonmakauuwiabut-abotnalagutanlumikhabumisitaturismoanaytatawaganinferioreserlindasimbahanlumiwanagnaglalaronapakahangakawili-wilioktubregumagalaw-galawyourself,yonpinauwievolucionadokapintasangnasagutanmagagamittennispaglulutolalabashumalopanindanagpabotnapakalusogcultureparehongkumidlatnanlakiendnakikia