Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "another"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

3. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

4. I always feel grateful for another year of life on my birthday.

5. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. spread information and knowledge from one corner of the globe to another.

8. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

9. The stuntman performed a risky jump from one building to another.

10. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

2. Kapag walang magtutulungan, walang magtatagumpay.

3. No hay mal que por bien no venga. - Every cloud has a silver lining.

4. Maligoy siya magsalita at mahirap maintindihan

5. Inihanda ang powerpoint presentation

6. I have been watching TV all evening.

7. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

8. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

9. Masama ho kasi ang pakiramdam ko.

10. Ang pagkakaroon ng sapat na tulog ay nagbibigay ng malinaw na pag-iisip at pagiging masigla sa bawat umaga.

11. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

12. Ang amoy ng bagong simoy ng hangin ay napakarelaks at mabango sa amoy.

13. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

14. You need to pull yourself together and face the reality of the situation.

15. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

16. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

17. Namnamin ang bawat minuto kasama ang iyong pamilya.

18. Esta comida está bien condimentada, tiene un buen nivel de picante.

19. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

20. If you keep beating around the bush, we'll never get anywhere.

21. Tanghali na akong makauuwi nito, nausal niya habang binibilang sa mata ang mga nakapilang balde.

22. Hinila na ni Kirby si Athena papunta sa table namin.

23. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

24. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

25. nadama niya ang bagong tuklas na lakas niyon.

26. Pwede ko ba makuha ang cellphone number mo?

27. Nandito ang mga kaklase ni Raymond.

28. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

29. Where there's smoke, there's fire.

30. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

31. Bumuga siya ng hangin saka tumingin saken.

32. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

33. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

34. Mayroong konsyerto sa plasa mamayang gabi.

35. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

36.

37. Magbantay tayo sa bawat sulok ng ating bayan.

38. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

39. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

40. El arte renacentista fue una época de gran florecimiento del arte en Europa.

41. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

42. Ngunit wala siyang nararamdaman sakit.

43. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

44. La realidad es que necesitamos trabajar juntos para resolver el problema.

45. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

46. Nasaan si Mira noong Pebrero?

47. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

48. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. El que busca, encuentra.

Recent Searches

anothertagtuyotskillpakealamappcitizenbehindduripancitstargracekumampilookedpowerlabannagreklamokainnapakagandanilapitanmagpa-ospitalshinesgabingnapakabangoguestsconditioninggrowthfacebooklutobaryoincreasekalakingnatutulogsay,namumulotzoopyestaeuphoricminutoactivitycandidateadvancementcarlobubongartificialbituinnapilingnagdaosnapapansinmanagersyncsignalmamahalindinbinibilangrecordedfarmapahamakilogbulalaspaanotools,bitiwanmatutongbelievedsinulidabundantenararapatnakatulogunidosdetallanbeyondkararatingnakabroadresponsiblegirlmarasiganphysicalaumentarsimplengikawasawaphilippineoliviastuffedbigongisinawakfameparehongpagkamanghasocietyipapahingadetectednagbentadanceibahagimagtagoamodiyanniyogramdamnatinsabihinnakakatandasiemprenasisiyahannilaosputidulapiecesmakinangnakagawianiskedyulmaluwangkinumutannakatapatbuwenasbowlboynearcapitalnangampanyanagngangalanganiladipangkulangvasquesnataposabutannakakadalawfederalroselleguardakommunikererlawstrasciendegaanobutiipinambilimarinigthroatdekorasyonnakuhangplantasmateryalesamerikateamspiritualfriendkomunidadbalotuwakviskunwafloorandoymenossumigawadecuadolipadmalabokarnabalmakakakaenhmmm4theverygrocerynagtatampongipingbosesheremawalafurynasabingminahantingkinahusoinasikasounibersidadpupuntahanipinangangakbighanilalotumagalbingirodonacrucialawardnakalilipassementongseryosoitinulostanyaghinalungkatnothingpagkatkutodelectronicpagkaraa