Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "another"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

3. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

4. I always feel grateful for another year of life on my birthday.

5. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. spread information and knowledge from one corner of the globe to another.

8. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

9. The stuntman performed a risky jump from one building to another.

10. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. You reap what you sow.

2. The hospital had a special isolation ward for patients with pneumonia.

3. Kina Lana. simpleng sagot ko.

4. Captain America is a super-soldier with enhanced strength and a shield made of vibranium.

5. She has been teaching English for five years.

6. Maglalaro nang maglalaro.

7. The bookshelf was filled with hefty tomes on a wide range of subjects.

8. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

9. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

10. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

11. Pawiin mo po sana ang kanyang karamdaman.

12. Hinanap nito si Bereti noon din.

13. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

14. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

15. Magkano ang bili mo sa saging?

16. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

17. Ang bola ay gumulong pababa sa hagdan.

18. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

19. Nabigla siya nang biglang napadungaw sa kanya ang isang ibon.

20. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

21. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

22. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

23. Mabait ang nanay ni Julius.

24. La música clásica tiene una belleza sublime que trasciende el tiempo.

25. Pinagsulat si Jayson ng pangungusap sa pisara.

26. Ang paggamit ng droga ay hindi lamang nakakapinsala sa kalusugan, kundi pati na rin sa kabuuang pagkatao.

27. They have been studying math for months.

28. The detectives were investigating the crime scene to identify the culprit.

29. Huwag mo nang papansinin.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. Hockey is played with two teams of six players each, with one player designated as the goaltender.

32. Bite the bullet

33. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

34. El estudio de la música ayuda a las personas a desarrollar habilidades importantes, como la creatividad, la concentración y la capacidad de trabajar en equipo

35. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

36. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

37. Marami ang nahuhumaling sa larong mobile legends.

38. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

39. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

40. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

41. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

42. Saan ka galing? bungad niya agad.

43. Andre helte er stille helte, der arbejder i skyggerne.

44. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

45. Matumal ang mga paninda ngayong lockdown.

46. Anong nangyari sayo? Bakit hinde ka nagkakakain?

47. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

48. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

49. Some couples choose to have a destination wedding in a different country or location.

50. Maraming paniki sa kweba.

Recent Searches

anothercrossbehindmalalimgraphicsangasisidlanmissionamericanmatipunoscottishbotomartesfamemakabalikhubad-baroinakalaitakpinilibinabalikoutpostcongressvideonaturalarghchambersgrabefistsscheduletabasleejeromecompartenknowledgeerrors,ingatanhusaynasawimagalingmgakisamepagdukwangkargahanhawaknahihiyangmarinigpinipilitumokaybayanibinaonnagsisilbikasamamalungkottunaydogmalilimutinminamahalillegalsasagutinnagbibirobalitalalakianthonylaganapnakakatabakapalknight10thmatamananahipakealamnaghinalaflaviopoong1929paghakbangskyldesadvancedgymkahulugankinagalitanbisikletalatecigarettesmamarilnungkindleechavekahariandyipniparaangpaglalayagtabing-dagathumpaykapangyarihanbestfriendbaduyfulfillingalituntuningalakkahitnayonkaniyangpakakasalanna-fundkayabangannaglokonagplaymanaloemocionessocialesnagpuyosnakakagalapanghabambuhaynamulaklakkamaopapanigkasamaanmagbibiyahenagtitiisnagkakatipun-tiponsagotpaki-ulitkanikanilangpaciencianagpakunotsangkaptulisanfactoresnatatawabalediktoryanestudiobayaningmalilimutanmahigitaustraliadealnakukuhalosssinapelikulamatulunginexperience,institucionesbigyanbateryapaskongbumotoparurusahaninihandaamingadvancenatulogpagputitusindvissalbaheibaswimmingsapagkatstyrelakadbagkus,constantlyinabotsubalitmeaningpalagimedidapancitsinimulanrelyandamingbecomecontent,numerosaskantomelissapakpakputahematangpingganscientificsamedatacontinuesgeneratecomunesfinishedstrengthmaduromagtatagalparacornerdietcreationmucheksamseenpositionerdoble-kara