Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "broadcasts"

1. Television has a long history, with the first television broadcasts dating back to the 1920s

Random Sentences

1. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

2. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

3. Iniintay ka ata nila.

4. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

5. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

6. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

7. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

8. Sana maintindihan mo kung bakit ako nagagalit at nag-iinis sa iyo.

9. Emphasis is the act of placing greater importance or focus on something.

10. Bwisit ka sa buhay ko.

11. Illegal drug traffic across the border has been a major concern for law enforcement.

12. Les travailleurs indépendants travaillent souvent à leur propre compte.

13. "A house is not a home without a dog."

14. Napaluhod nalang siya sa harap ng palasyo at umiyak.

15. Huwag po, maawa po kayo sa akin

16. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

17. Ang ganda ng swimming pool!

18. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

19. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

20. May himig pangungutya ang tinig ng pulis.

21. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

22. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

23. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

24. Nationalism has been a driving force behind movements for independence and self-determination.

25. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

26. May konsyerto sa plasa mamayang gabi.

27. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

28. Naputol yung sentence ko kasi bigla niya akong kiniss.

29. A new flyover was built to ease the traffic congestion in the city center.

30. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

31. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

32. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

33. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

34. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

35. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

36. Palaging basahin ang alituntunin ng isang lugar.

37. Ang kamatis ay mayaman din sa vitamin C.

38. Mathematics is a language used to describe and solve complex problems.

39. "Dogs come into our lives to teach us about love and loyalty."

40. Nationalism is often associated with symbols such as flags, anthems, and monuments.

41. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

42. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

43. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

44. Saan ka galing? bungad niya agad.

45. Kinaumagahan ay wala na sa bahay nina Mang Kandoy si Rabona.

46. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

47. Naglalaway ang mga aso sa amoy ng pagkain na inilabas sa kusina.

48. Danmark eksporterer også mange forskellige typer af maskiner og udstyr.

49. Ngumiti muna siya sa akin saka sumagot.

50. ¡Muchas gracias!

Recent Searches

releasedbroadcastsprovidedwhymarkednerissastagebehalfagenaghihirapgawinpalancamaramiikinatuwakahusayannaghinalamakatikaninapinagsasabipresence,paparusahanpapelbaketpoolricapatakbongnageenglishkainanmakaratingnilulonhalamanpitomagturojoshuapakikipaglabanfacultytaasmangiyak-ngiyakdeletingkabighanagpapaniwalabilaonanalonapuputolbahagisulingannakumbinsiposternatatapostinaposaaisshnapakaningningahhhhtungawinvesting:productividadkapatidnewsconsumetillspentnagwikangasawacosechasbumabalotminuteyamanparesusibingbingmapaibabawangkantelevisedklasrumnahuhumalingkayanasaproblemashapingpriestnanonoodsuccessanydesarrollaronstocksaffectstayhumahangosattorneymedidapinauwisulyapkulungantabing-dagatsimulafrancisconagingempresasbiologidilagdumilatplayselementarymarielnasasakupanpakibigayibinilibilibidpondokagabiabrildiyanlarawaniwanantilakaarawanpagkamanghapaglalayagtrabahopilipinasmatalinonatatangingsalestemparaturapaulit-uliteleksyoneasyhinanakittaracubakabarkadaaregladobateryakinalimutanpalakanaglabananinaemocionanteuulaminpagkatakotmahiramthanksgivingpinagkasundoikinuwentonagsunuranjemikulturtakipsilimituturotutungogenerationsairportpresidentialtanggalinbinatilyojoebasarestaurantkutomasasabitekatigrepitongtinapayanak-mahirapabotpinaladpinipilitmarangalano-anonaglalaroumuulanibabawmaunawaanunanprogramamababawmatulogmailapsupilinteknologisumindisiyangnatakothidingsuriincasakamalianfilipinopagdamigumuhitchecksopomapaikothinamaktsinamakilingmarahilpagpapasandatapwat