Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "dadalawin"

1. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

2. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

Random Sentences

1. Every year, I have a big party for my birthday.

2. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

3.

4. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. He does not play video games all day.

7. The French omelette is a classic version known for its smooth and silky texture.

8. Su obra más famosa es la escultura del David en Florencia.

9. If you think I'm the one who stole your phone, you're barking up the wrong tree.

10. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

11. Le chien est très mignon.

12.

13. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

14. Nakakatawa? mataray na tanong ko sa kanya.

15. The acquired assets included a portfolio of real estate properties.

16. When he nothing shines upon

17. The love that a mother has for her child is immeasurable.

18. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

19. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

20. La arquitectura de la catedral es sublime, con sus detalles ornamentales y grandiosidad.

21. Ang mumura ng bilihin sa divisoria.

22. Palaging sumunod sa mga alituntunin.

23. Hinugot niya ang kanyang karanasan sa trabaho upang makapagsimula ng sarili niyang negosyo.

24. The victim's testimony helped to identify the culprit in the assault case.

25. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

26. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

27. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

28. Pull yourself together and let's figure out a solution to this problem.

29. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

30. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

31. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

32. Bumibili si Rico ng pantalon sa mall.

33. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

34. She does not skip her exercise routine.

35. Gusto kong bumili ng bestida.

36. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

37. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

38. Tengo dolor de oídos. (I have ear pain.)

39. Some fruits, such as strawberries and pineapples, are naturally sweet.

40. Tengo vómitos. (I'm vomiting.)

41. Ang lalaki ng isdang nahuli ni itay.

42. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

43. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

44. La tos puede ser tratada con terapia respiratoria, como ejercicios de respiración y entrenamiento muscular.

45. Hindi ako nakatulog sa eroplano.

46. No pain, no gain

47. The cutting of the wedding cake is a traditional part of the reception.

48. Ang paggamit ng droga ay maaaring magdulot ng pagkakaroon ng mga karamdaman, tulad ng mga sakit sa puso, kanser, at mga problema sa paghinga.

49. And often through my curtains peep

50. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

Recent Searches

dadalawininasikasogulatbumisitainirapanmangahasuugod-ugodngumiwihulumakikitulogmahinana-fundsabihinmagkakaroonkatuwaanstrategiesmananakawdireksyonfullbowlnakahainsasakaylumabasinuulamkapintasangpinauwiintindihinnapatigilmaanghangmakapagempakealapaaphabitsbinuksanbefolkningensaktankalabanincitamentersuriinlagnatnanonoodnewsnaabotpakibigyanmalalapadpasaherokinukuyompalitanninataksipinalambothinagismaestrasarongpagbatinatatanawvitaminhotelmonumentopalakaninyoganunandoybutonahulaannapakomaalwanglupainlabahinnagkaroontalentbingbingsumakayhetoalaalareguleringadditionally,nenasundaemanghulilegacydalagangmaluwanggatheringbusiness,semillasonlinelandojosegeneproductiontwitchamerikaarguebingobotedisappointshortjacepaysellkamatisrailwayspinatidisugamagbasacommissionabonoheybeintelackfonoemaillaterhundredcongratsdolyarstevepasanbahabinabalik1973hapag-kainanmumuraipongseenanimdoonplanrelativelyabsyonmapakaliexpectationshadtipidfacilitatingheftygapprogramavisualenvironmentbroadcastsmediumlargeevilprovidednariningregularmentethemganapinpagkakapagsalitaremembermakakuharicalaylayutak-biyamagbantayworldbalediktoryankargahanpartssapagkatcountlesssinopaanonahintakutanlasapagputimandukotkalongbumabahanag-oorasyoninomcontinueseditorwebsitepagkalungkotatentobecameencompassespalikurannecesariogitanaslalawiganmasayang-masayabumuhosvotesdiamondngayongangalkumulogmangyayarinakahigangmesalingidmakuhagabi-gabiconvertidashouseman