Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "south korea"

1. Aalis na ko mamaya papuntang korea.

2. Grabe ang lamig pala sa South Korea.

3. Musk was born in South Africa and later became a citizen of the United States and Canada.

4. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

Random Sentences

1. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

2. The bride and groom usually exchange vows and make promises to each other during the ceremony.

3. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

4. Me gusta mucho dibujar y pintar como pasatiempo.

5. Natawa ang bata ngunit pumayag din ito.

6. Twinkle, twinkle, all the night.

7. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

8. Sa may ilalim, nakuha niya ang kulay-lumot niyang kamiseta.

9. Huwag masyado magpaniwala sa mga nababasa sa internet.

10. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

11. The dog barks at the mailman.

12. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

13. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

14. Las hojas de los cactus son muy resistentes y difíciles de cortar.

15. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

16. Ang agila ang pambansang ibon ng Pilipinas.

17. Patulog na ako nang ginising mo ako.

18. Pagkababa, mabilis na siyang nagyayang umuwi.

19. Gracias por hacerme sonreír.

20. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

21. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

22. Sa isang linggo ay pupunta kami sa Singapore.

23. El realismo y el impresionismo son estilos populares en la pintura.

24. Sa kabila ng pagkamatay niya, ang diwa at mga ideya ni Jose Rizal ay nananatiling buhay at patuloy na nagbibigay-galang sa kasalukuyang henerasyon ng mga Pilipino.

25. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

26. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

27. Pumasok po sa restawran ang tatlong lalaki.

28. Busy yung dalawa. Si Aya nandito. sagot ni Lana.

29. Paano mo pinaghandaan ang eksamen mo?

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Beauty? tanong pa ni Mrs. Lacsamana.

32. Don't count your chickens before they hatch

33. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

34. Magkita na lang tayo sa library.

35. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

36. May konsyerto sa plasa mamayang gabi.

37. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

38. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

39. Nagpunta ako sa Hawaii.

40. Naramdaman kong nag vibrate yung phone ko.

41. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

42. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

43. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

44. Kasabay ko si Anna na magtanghalian sa canteen.

45. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

46. It’s risky to eat raw seafood if it’s not prepared properly.

47. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

48. Pagkasabi nya nun bigla syang ngumiti agad, Walang bawian.

49. Football players must have good ball control, as well as strong kicking and passing skills.

50. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

Recent Searches

daangkaraniwangnapakamisteryosokarapatanhumanosmoneytradisyonkuyakusinacultivashoppingstreetstorytirangloanscompanieslot,brasopwedesisentahinalungkatreplacedtanghalitalinolumbaymatikmankailanmanmerchandisekasuutanpalipat-lipatiskomagandangkisamefederallittlebecomingmalawakagetelebisyonsumasakaynewsnakayukodiplomaplankirotbilihinsikonakakainartistsrobinhoodspeedrevolucionadosinkbilaomukamakasilongtig-bebeintepagtiisanaplicacionesnaabotkongresochooseunangmaramotmalihishinigitmagtakapagkaimpaktoanitoetoinventiontumatanglawpitumpong2001criticskitanapakotungkolpagguhitboxmagsasakatamarawkumampieleksyonhmmmmmaghihintaymakikiligonanahimikagosphysicalfionangingisi-ngisingmarketing:nagpabayadmandukothayaangmalampasannasasabingespadaentermagpahabatanyagleosiguradosarongreservationna-curiousihahatidferrerpaamaitimmaistorbosincegapbalingbawianginoomanggamangyariritomalakipalayoknagpuntabluelumusobimaginationfalladatanagreplymakakawawamenuharingupworkcallmulighedersusunduinisamaeffectsbroadcastingnagdiretsoexitstringexplainiginitgitpapayagcontestpa-dayagonalso-calledlumabasipipilitproperlyevolvedlabanantooladditionallybabaingrepublicmagta-taxiressourcernepintuantaingapaulit-ulitmakalabasnagulathumabolngayongmagalitkaninlitsoncover,forståokaypakakatandaanlinggokatutubokinaumagahanmaaksidentemanagernagwaliskoreapinagtulakanmahiyaterminosenatemalagokahalumigmigantinulak-tulakmakatawanagmamaktolbandakikotiptulongtuwaculturesnagugutomalapaapibabawgirlfriendkararating