Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "star"

1. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

2. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

3. Twinkle, twinkle, little star,

4. Twinkle, twinkle, little star.

Random Sentences

1. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin sa buhay sa tulong ng pananalig sa Diyos.

2. Wie geht es Ihnen? - How are you?

3. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

4. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Ngunit ang bata ay naging mayabang.

7. Supporting policies that promote environmental protection can help create a more sustainable future.

8. El nuevo libro de la autora está llamando la atención de los lectores.

9. Gusto mo ba ng mainit o malamig na kape?

10. Ang edukasyon lamang ang maipapamana ko sayo.

11. Beast. sabi ko pagkalapit sa kanya.

12. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

13. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

14. Good morning din. walang ganang sagot ko.

15. The rise of digital currencies and payment systems is changing the way people use and think about money.

16. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

17. Nagbiyahe ako sa Mindanao noong isang taon.

18. Maliit lang ang kusina ni Lola Oliva.

19. She has learned to play the guitar.

20. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

21. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

22. Ang guro ko sa heograpiya ay nakatulong sa akin upang maunawaan ang kahalagahan ng mga kalupaan at karagatan.

23. The study of viruses is known as virology, and scientists continue to make new discoveries about these complex organisms.

24. Ano namang inasikaso mo sa probinsya?

25. Palibhasa ay madalas na mas matalino kaysa sa ibang mga tao sa kanyang paligid.

26. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

27. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

28. Before television, most advertising was done through print media, such as newspapers and magazines

29. Sinabi niya sa dakong huli na gusto na niyang mag-resign sa trabaho niya.

30. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

31. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

32. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

33. Ang pagpapahalaga at pag-unawa ng aking mga magulang sa aking sitwasyon ay nagpawi ng aking lungkot at kalungkutan.

34. Mabini ang sumulat ng konstitusyon ng unang Republika ng Pilipinas.

35. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

36. Tengo dolor de oídos. (I have ear pain.)

37. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

38. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

39. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

40. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

41. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

42. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

43. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

44. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

45. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

46. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

47. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

48. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

49. Las escuelas pueden ser públicas o privadas, coeducacionales o exclusivas para hombres o mujeres.

50. Break a leg

Similar Words

starredstarsestarstarted:startstarted

Recent Searches

starnagtitindamayotowardsoraslangkaybatok---kaylamignaligawtinangkavariousindustrykaraokebuongpagkamanghatulongmakipagkaibiganisangcontentnakiisaydelsersamantalangnapuputolremaintechnologynararanasan1940nagitlaabundantenagbiyayaphonemarsotumabapagtungopananglawpag-asahaveditokendireallyqualitybanlagnahulogmangyaribuwisnagsuotmatanggapkadalagahanginuminnuevacasakatagangipapainitpangarapmalasnecesitadumatingtag-arawhimayinpaananmakatulogskillsmulighedhumiwalaypasasaanmoderneschoolsthanktipkalayaanreturnedpeer-to-peerkagandapinagsanglaansumalanakakatulongmakilalavaliosakulisapintocarlosopasmahiwagaorganizetransportmidlerdrogaincitamenternakatuonrevolutioneretkamustatatanggapinnatinagjamesmaalaladidreferssigematatandanakauslingmahahabangmagbubukidsinepopularibinentapanalanginpunohomeworkbalikatjuicedisposalnakatanggapdinalatatayonangalaglagtaga-lupangnasasalinanmahigitmatamismagpuntatwo-partykommunikerernangahasalamidinformationbesideshoneymoonnakikitangmarahanhouseholdnagpepekesalatinpinalalayasreachsinabiakoconcernnanigasmallgradgraduationfeelmauupotirahannagtagallapissabermakinigsisentaalas-tressbulaterecentlynakakatakotaddprovideactionestablishpalayanfencingbumilijulietnicosaradomanmeresentimosgripokingappnatutuwapabiliefficientstonehamtradicionalmatagpuancryptocurrencyplacenakasuotkumaripasavailablemobilelibongnamalaginakaka-inkaninangpisngipagkikitapinagalitanpokertaomaagapannatatawaituturopinag-aralanhayopimportanteeachpersistent,surgerygatheroverallfactores