Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ctricas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. The team's colors are purple and gold, and they play their home games at the Staples Center.

2. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

3. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

4. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

5. Ngumiti lang sya, I know everything, Reah Rodriguez.

6. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

7. Ano pa ho ang kailangan kong gawin?

8. I have been swimming for an hour.

9. Stocks and bonds are generally more liquid than real estate or other alternative investments.

10. The bakery specializes in creating custom-designed cakes for special occasions.

11. The disagreement between them turned out to be a storm in a teacup.

12. Bukas ay pupunta kami sa isang medical mission.

13. Agad siyang tumalikod at tuluy-tuloy na pumasok.

14. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

15. Bakit ka nakitulog sa bahay ng kaibigan mo?

16. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

17. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

18. Magtiis ka dyan sa pinili mong trabaho.

19. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

20. Kailangan natin ng mga kubyertos para makakain ng maayos.

21. Despite his success, Presley's personal life was plagued by controversy

22. Marami ang nahuhumaling sa larong mobile legends.

23. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

24. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

25. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

26. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

27. Einstein's brain was preserved for scientific study after his death in 1955.

28. He has improved his English skills.

29. I am teaching English to my students.

30. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

31. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

32. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

33. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

34. Electric cars have lower fuel costs than gasoline-powered cars since electricity is generally cheaper than gasoline.

35. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

36. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

37. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

38. Noong una ayaw nilang paniwalaan ang bata ngunit di naglaon ay tinikman din nila ito at napag-alaman ngang matamis ang bunga.

39. Estoy muy agradecido por tu amistad.

40. Ang pagiging hospitable ay likas na katangian ng mga Pinoy.

41. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

42. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

43. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

44. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

45. Huh? Anong wala pa? nagtatakang tanong ko.

46. ¿Cuándo es tu cumpleaños?

47. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

48. What goes around, comes around.

49. Bumili ako ng sapatos sa Shopee.

50. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

Recent Searches

ctricasmaglalabahanapinrequierennagplayhawlanagwikangminerviegalaanalanganmahuhuliimpactsnanghuhulikumikiloshawinecesariomagkaibabintanapookmanoodpapuntabuwayabulongangalnochenanoodkainissementomatulunginaustraliamaglabaarabiacommunicationmakahingipinagkasundomataasantokarteahassumisidmaghahandaself-defenseaddsapilitangelenabinentahancapableconsiderarkalimutanhabitslimitedparurusahankabuhayanabanganknightadditionally,heartbreaktsssbinibilangginawaplatformshayopalaktitigilnaaksidenteendingulongsaturdayleksiyonsasamahantungobotanteklasrumschoolboholnaggalagoshsoundgaghveroutpostpadabognapakabilisechavepartkumirot1935nakakapasoknanamaninalalapagkatparaeraphouseholdbumabalotmelvinbyemalagoresearch:intensidadskills,oktubrepamilihanlihimalilainsumpainradioproductionritomakaindettenapatingalabalancesmournedtiketkatandaanpalagitanimharapanmagisingstringricapagkatakotibonhesusemphasismahihirapnapakaalatguidefindegatherbiyayangpananghalianipaghandasupilinperformancemalapalasyopiersueloagilitymuldemocraticbaguiodalandanjackzstaribat-ibangpagkakakawitdalawsellharingmagpuntadagagraphicnagmistulangfrescotiisfloornamumulotmalilimutanmganakapagproposemabihisansadyang,eleksyonpetsangsalelungsodnakasilongnatitiyakmagpapaikotlalawiganfactoresabscolourpressbubongnaroonjackycommunicationspedecountriespupuntapapayagnag-asaranpagmamaneholumindoliikutanrailkaibangvocalbitaminatuwangpinakatuktoknagkikitasurgerypetsapangalanlibagpasadya