Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ctricas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Maaring ibigay ng guro ang libro sa akin.

2. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

3. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

4. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

5. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

6. We have been painting the room for hours.

7. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

8. Scissors have handles that provide grip and control while cutting.

9. Accomplishing a long-term goal can create a sense of euphoria and relief.

10. May naghubad na ng damit at isinampay na lamang sa balikat.

11. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

12. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

13. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

14. My mom always bakes me a cake for my birthday.

15. Kung minsan, akala ng mga tao, masungit siya.

16. Mahalagang magkaroon ng financial literacy upang malaman kung paano ma-manage ang mga utang.

17. Iyon pala ay isang diyosa na nagpapanggap lamang.

18. The bakery specializes in creating custom-designed cakes for special occasions.

19. The Lakers have a rich history and are one of the most successful franchises in NBA history.

20. Seperti katak dalam tempurung.

21. Ang ganda pala sa enchanted kingdom!

22. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

23. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

24. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

25. Paano ho ako pupunta sa palengke?

26. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

27. He has written a novel.

28. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

29. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

30. Anong oras gumigising si Cora?

31. They watch movies together on Fridays.

32. The detectives were investigating the crime scene to identify the culprit.

33. Driving fast on icy roads is extremely risky.

34. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

35. Arbejdsgivere leder ofte efter erfarne medarbejdere.

36. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

37. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

38. Limitations can be financial, such as a lack of resources to pursue education or travel.

39. Magalang na hiniling niya ang tulong ng guro sa kanyang takdang aralin.

40. It's frustrating when people beat around the bush because it wastes time and creates confusion.

41. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

42. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

43. Aaissh! biglang upo si Maico pagka-maktol.

44. Oh! What a coincidence, dito ka pala nagtatrabaho?

45. Bumili si Ana ng regalo para diyan.

46. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

47. Dahan-dahang naglayag palayo ang bangka mula sa pampang.

48. Would you like a slice of cake?

49. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

50. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

Recent Searches

ctricasmagsaingtiyankinanapadaanlayuansumasaliwinfusionesinventionmagdaanomfattendecompletamentealagaaraw-mangingibigarkilayorksisidlanpulitikonasanapagodsumpaino-orderwinsdustpandagatginaganooninihandaaffiliateproducts:determinasyonmissionnenavivaangalnogensindemaidnapansinbansangparolandepatayilocosmalamangtupelotignangodtrestauranticonsfrescolingidgatheringpisopangitlendingblazingencompassesgearpariaabotvalleyxixcrazyevilhapdifurtherhatingendhoweverplandarkbitawanadditionallyjoyalindancecompartensorrybinabalikginisingpasanumiinituriroonmatangtherapymarchlatemungkahidevicesiosmapadalipollutiondumatingpromotinglorenadahonmabutingleesurgerytrackentryshiftcomplexandreipinalutoeditorwhethercirclebroadcastsbroadcastingseparationpinalalayastaxigumuhittumamananonoodlagnatnakilalapabulongskirttinataluntonfactorespoongintramurosvirksomheder,kumukuhapinagmamalakibabyinagawtumiraengkantadangkinalilibinganmagpapigilnanaloyumaomaibibigaynagwagimaisusuotkalakinagsuotaggressiondinalaclientesspeechstagecouldoffentligformdebatesaminggenerateordertrainingkuborestawranmatitigasisinumpa1960spersonbiyasenergyangelaaaisshanumankambingngipingtagaknagdiretsotanggalinnakaraanfitnesskumikilosnakikitangtaun-taoninilalabasnagpagupitpaglisanmagpapagupitsang-ayoncareressourcernemanlalakbaysalamangkeropotaenalumalangoykinatatakutanikinamatayhumalakhakpowerskasalukuyanpagkalungkotnakapamintananagbabakasyonhalamangabihinawakannakaririmarimkapatawaranpamamasyal