Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ctricas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Mathematics is an essential subject for understanding and solving problems in many fields.

2. Hello. Ito po ba ang Philippine Bank?

3. La seguridad en línea es importante para proteger la información personal y financiera.

4. Maganda ang kulay ng mga puno sa panahon

5. Wala naman sa palagay ko.

6. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

7. The hiking trail offers absolutely breathtaking views of the mountains.

8. Ang poot ay isang pusong nasaktan na lumalaban upang mabawi ang dangal at dignidad.

9. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

10. The early bird catches the worm.

11. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

12. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

13. Television also plays an important role in politics

14. Mayroon kaming bahay sa Tagaytay.

15. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

16. Hang in there."

17. Gusto ko ng mas malaki pa rito.

18. Dogs can provide emotional support and comfort to people with mental health conditions.

19. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

20. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

21. Sa Manila Hotel ka titigil, hindi ba?

22. They plant vegetables in the garden.

23. The church organized a charitable drive to distribute food to the homeless.

24. Bumili si Andoy ng sampaguita.

25. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

26. Repeated frustration can lead to feelings of hopelessness or helplessness.

27. He does not waste food.

28. Hello love birds! bati ko sa kanila nang makalapit ako.

29. Gracias por escucharme cuando más lo necesitaba.

30. Saan ka galing? Dalawang araw na ako dito ah! aniya.

31. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

32. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

33. I got my sister a cake and wrote "happy birthday" in frosting on top.

34. Software er også en vigtig del af teknologi

35. Aray! Bakit mo naman ako sinapok!

36. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

37. Ipinagbabawal ang paglapastangan sa mga simbolo at sagrado ng mga kulto at relihiyon.

38. Pantai Sanur di Bali adalah pantai yang menawarkan pemandangan matahari terbit yang indah dan tempat yang bagus untuk bersantai.

39. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

40. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

41. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

42. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

43. Yari sa kahoy ang sahig ng bahay ko.

44. Ang aming angkan ay mayroong mga natatanging tula at awitin.

45. Tumama ang kanan niyang pisngi sa labi ng nabiawang balde.

46. The blockchain technology underlying cryptocurrency allows for secure and transparent transactions.

47. Hindi ko ho makain dahil napakaalat.

48. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

49. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

50. Wala naman akong sinabing ayaw ko ah?

Recent Searches

ctricasbaowaiterpusainaabotbinibilitigaspagkakahawakminamadalicharmingfriesaudio-visuallyahasoutpostproducirnogensindereportpdadidspaghettitracktelaritaattackauthorchefbringingimposiblemarilousharingpaangmakapagsalitamaiingaytiyakanpadremakalabasimpactoantibioticstulisang-dagattsuperbumigaystevesoportepedengpaketehomeworkliableiiwanpagsahodnyenobelanatayonangyarinakasakaymay-arimakabangonmagjoshjosefaexplaindibisyoncombatirlas,closecalciumtumambadtinitirhanreviewerspag-aapuhapmediumctilesmakamitluislaborclassesaffectunibersidadthroughoutsocialeriskreservespuntaonceobstacleskalakinginakyatiloiloilalagayisinawakhumpayhawaiiferrerbuwenaspulgadabiocombustiblesstrengthsilaysasagutinpayapangkisskikitacreationaddresspumikitpagkainisdiwataamplialegendkamandagdiseaseresearch:nakihalubilotilathereforepublishednareklamomagasawangtinitignanmaibigaymakakatakaspinapalogawinbasketballagaw-buhayprovidedkumukulowalongnobleboyetlineespadamalabokayanatakotsumasakayisasamaumabotna-curiouspinabulaanpapuntangsumindifionapiyanodipanghmmmmnagtatampospiritualnaismustmalayamoremisakamiasmicamestmensmemomejomeetpinangyarihannagdiretsoemocionantemapamanymangmaidlutolossloribiyerneslolodispositivoyumabanglolanaiilaganliveliv,lendlawslatelasalarodaladalasinalansanhikingnagpuntalanglandlalomabaitlackkungkenjikuboknowkinglalamunankinakilokikoathena