Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ctricas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Ano ang nasa bag ni Cynthia?

2. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

3. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

4. Natawa kami sa inasta ni Sara dahil para siyang bata.

5. I'm sorry, I didn't see your name tag. May I know your name?

6.

7. El diseño inusual del edificio está llamando la atención de los arquitectos.

8. The ad might say "free," but there's no such thing as a free lunch in the business world.

9. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

10. ¿Dónde vives?

11. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

12. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

13. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

14. This can generate passive income for you, but it does require some capital to get started

15. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

16. Goodevening sir, may I take your order now?

17. El powerbank utiliza una batería recargable para almacenar energía.

18. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

19. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

20. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

21. Seeing a favorite band perform live can create a sense of euphoria and excitement.

22. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

23. Puwede ba sumakay ng taksi doon?

24. La realidad siempre supera la ficción.

25. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

26. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

27. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

28. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

29. Ayon sa doktrina ng Simbahang Katoliko, ang purgatoryo ay isang lugar kung saan ang mga kaluluwa ay nag-aayos bago pumasok sa langit.

30. Ang kumbento ang madalas tambayan ni Father at Sister.

31. Nagmadaling maglakad si Kenji papalapit sa amin ni Lucas

32. Paki-bukas ang bintana kasi mainit.

33. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

34. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

35. Maarte siya sa pagpili ng kanyang mga kaibigan kaya hindi siya basta-basta nakikipag-usap sa mga tao.

36. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

37. Bukas ay mamamanhikan na kami sa inyo.

38. The credit union provides better interest rates compared to traditional banks.

39. The project is taking longer than expected, but let's hang in there and finish it.

40. Isa sa kanyang kasamahan sa bilangguan ay si Tony

41. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

42. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

43. Emphasis can be used to create a sense of drama or suspense.

44. Be my girl, Jacky. bulong niya sa tenga ko.

45. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

46. Television has a long history, with the first television broadcasts dating back to the 1920s

47. Ang Linggo ng Pagkabuhay ay pagdiriwang.

48. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

49. Di ka galit? malambing na sabi ko.

50. Ang mabuting anak, nagpapakilala sa magulang.

Recent Searches

kumainmaghapongctricasvalleyguronakatinginreynamaalwangricomabutimariloudreamsawardlangkaylupaininiintaymatigassumingitklasengpinalayaspagkatathenaantokilagaysurroundingsapologeticgagpatayedsajenapasigawtoyiskedyulkabuhayanpalmakapaingardenenergiadditionally,gamitindipangmakasarilingnicotarcilatshirtblusaipantalopkasingtigascomputere,arguetanodhomeworkactingpasyarestawanblueiroglulusogcornersemailworrybinigyangpocakulisapstillmisusedpedrosubjectisinalangelviscupidshowsisugabagolapitanamerikastreamingipagtimplaataquestrackdonaleideadingginmetodeshockcolourformscomputerdevelopincludepackaginghellogotaggressionulodoingwindowpasinghaluniversalculturanahuhumalingwaysdumikitjohnnagpapakinissilbingtinawananbulakalaktinataluntonkaramihanlinggongerrors,medikalnapapikitmapangasawaapoykwenta-kwentasiyang-siyaluluwasnunoagostolargerbinuksanikinakagalitmobileexperttopicsalasasakyanlumutangvedvarendeomfattendefysik,tumigilabledisposalculturaliikotherramientasiniirogmacadamiaakalaingannanapatawagpaga-alalamalezapagpapasanpagtatanongbloggers,tuluyannananalokonsultasyonpinakamatapatnabalitaanpinakamatabangvictorianagtakanalakinawalangnalagutanentrancekapasyahanflyvemaskinermakuhangbagsakpinasalamatanmensajespumapaligidnagsisipag-uwiannagliliyabgobernadornakatunghaykonsentrasyonnalalaglaggayunpamanmagbagong-anyotabing-dagatpaglalabawatawatnaiilangmagsugaltangekshayaansinaliksikawtoritadongmananalopagkuwanmakatulogtemparaturanagtungomaghihintayisusuotmagtatakalumipadsignalkilongkontinentengnahahalinhangumuhit