Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ctricas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. We need to optimize our website for mobile devices to improve user experience.

2. Two heads are better than one.

3. I love the combination of rich chocolate cake and creamy frosting.

4. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

5. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

6. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

7. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

8. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

9. He is not having a conversation with his friend now.

10. The wedding ceremony is often followed by a honeymoon.

11. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

12. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

13. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

14. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

15. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

16. Namilipit ito sa sakit.

17. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

18. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

19. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

20. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

21. Binigyan niya ng kendi ang bata.

22. He has been gardening for hours.

23. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

24. Gumising ka na. Mataas na ang araw.

25. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

26. The company used the acquired assets to upgrade its technology.

27. La pimienta cayena es muy picante, no la uses en exceso.

28. Ano ang gagawin mo sa Linggo?

29. Arbejdsgivere leder ofte efter erfarne medarbejdere.

30. Ang matanda ay nagalit at pinalayas ang bata.

31. Hindi dapat natin balewalain ang mga taong nasa paligid natin, datapapwat ay may mga pagkakataon na hindi natin sila napapansin.

32. Parehas na ayaw magbigayan ang dalawang pangkat at pinipilit na sila ang mas nararapat kaysa sa isa.

33. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

34. Malaki ang kanilang rest house sa Tagaytay.

35. Nahantad ang mukha ni Ogor.

36. But television combined visual images with sound.

37. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

38. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

39. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

40. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

41. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

42. Ang mahal pala ng ticket papuntang Amerika!

43. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

44. Ano-ano ang mga projects nila?

45. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

46. Eh? Anlabo? Hindi mo naman kaboses yun eh.

47. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

48. Puwede ba sumakay ng taksi doon?

49. Hudyat iyon ng pamamahinga.

50. The event was sold out, and therefore we couldn't get tickets.

Recent Searches

nalugodctricascompositoresglobebringkagandahanalinsumigawmangungudngodpakanta-kantangrailsumalakaytalafreedisenyotinderatutorialstechnologicalcrazymerchandisemagtiwalamagkakaanakinastabestidamagitingnandiyannakabaliksharmainemisteryotinangkamaidnahintakutandeathgalakpasalamatannanayninonglightsfonoscharitablegabingaaliselectedcoughingmagsasakasisentanagbungascalecallmanatilipangalananinalalayankatandaanlegislationmariedaangpicturespundidonaglokoawitanglobalisasyonkailanmalayangbihirabaitleadnamumulamaglalakadrightsgodibinubulongkaklasekutodpamamagitanabonoelectparagraphsabrilnagdalaamendmentsautomationmanakbohighestpopcornpunsostrategypakibigaytendeliciosaadvertising,nahawakankabutihannagpapaigibmaghahabikampeonkasamaangmaliitpunong-kahoyformsmind:minu-minutopagbahingincludeuncheckedbagomakatarungangmanghikayatevensumisidsinabikadalagahangfederalnagpakilalamarkdialledlibrointernaprobablementehumayoestateincluirhehepropensomaihaharappatungomalakiparkesarilipalakakalakingipingmasasamang-loobwaridenpinapasayamagkikitamasaktanuusapaninfluencesnagagandahanpagtataaslikasinteractnagyayangmartespresidentialpesoskasowebsitemagsusunuranandybukaslaloopgaver,pagiisipbakaculturemanonoodpotentialsakalingagadbibigyannapapadaandingginreadingpusoitinulosyoutube,kanilaabspantalonaddressngunitmerrykaraokebinulongsinisiralalabhanmagbigaynalalaglagdalawapabalangpulubimeetuulaminleksiyoninilistanerokaugnayanseryosongpapasokmaibibigayordernagtungoibilihadgayunpamanmakakakaenfuncionescircle