Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "figure"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Eh? Considered bang action figure si spongebob?

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

5. Ilalagay ko 'to sa mga action figure na collections ko.

6. Pull yourself together and let's figure out a solution to this problem.

7. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

8. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

9. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

2. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

3. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

4. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

5. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

6. The company’s momentum slowed down due to a decrease in sales.

7. Some fruits, such as strawberries and pineapples, are naturally sweet.

8. Ang aking ina ay isang magaling na mang-aawit.

9. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

10. She is designing a new website.

11. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

12. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

13. Ang alin? iyamot na sabi ko habang nakapikit na.

14. Le livre que j'ai lu était très intéressant.

15. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

16. Nag-aabang sa langit, sa mga ulap, sumisilip

17. Paboritong laro ng kuya ko ang basketbol.

18.

19. Iyon pala ay isang diyosa na nagpapanggap lamang.

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. Hindi na maganda ang asal ng bata ayon sa diyosa.

22. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

23. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

24. Hospitalization can be a time for patients to focus on their health and receive specialized care.

25. Pero sa isang kondisyon, kailangang bayaran mo.

26. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

27. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

28. Hinipan-hipan niya ang manipis na dibdib.

29. Sino-sino ang mga pumunta sa party mo?

30. Nang dumalaw muli ang kanyang ama, pinatawad na niya ito at maging ang kanyang ina ay tuluyang gumaling at napatawad pa rin ang asawa.

31. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

32. Kumain ako ng macadamia nuts.

33. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

34. Lazada is one of the largest e-commerce platforms in Southeast Asia, with millions of customers and sellers.

35. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

36. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

37. My favorite thing about birthdays is blowing out the candles.

38. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

39. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

40. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

41. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

42. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

43. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

44. They are cooking together in the kitchen.

45. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

46. We have been cooking dinner together for an hour.

47. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

48. Nais ko sanang malaman ang mali sa katotohanan

49. They are often served with a side of toast, hash browns, or fresh greens.

50. Nasaan si Trina sa Disyembre?

Similar Words

figures

Recent Searches

figuremind:viewsdevelopmentefficientbituinvisualuniqueactorberkeleywhykayang-kayangmapangasawangitipedenakakatabanagpabayadginhawapaciencianakakaintig-bebeintepatawarinnovemberhumihingitasaejecutannakakatandapakilutokinainbilugangwarieffort,nogensindechoiceexcusefatalchessinasikasopanatagnakakaanimmagsabiindustryisinalaysaynewspapersmanlatestlikodabshalagaboksingmotionjosieproveryanvillagetsismosamakakabaliknagbibigayankabighanabigayantesagam-agamkarapatannilulonsasayawincryptocurrencyhallfurkarnabalagospreviouslyhimkarangalanpupuntahanmalilimutanbagorobertperfectsalitanghatinggabimatandang-matandacomputerbahagihimutokgabingnunonakitulogjaceallowedalas-dospagdudugokukuhanagtutulungankalalakihannagreklamopagtutolkalabawgustongcallerginaganoontayosakaymatipunonakacarlomaarilamanmakatarungangomeletteinsteadsatisfactionmagpa-ospitalpagkakayakaphandaannagkasakitawtoritadongpaglalayagginagawahousetelebisyonmalakasmakilalalumusobsamantalangjagiyahelenatulalabuwanbangpostcardtools,kasicuandocontrolledngingisi-ngisingpinuntahannalakitangekskondisyonmatatagnakalocklot,paakyatmaranasankaninabibilinilapitantsinelasgananghanginmaistorbonaglabanandahongrocerypinakamalapitmurangeleksyonnamamayatkisapmataincludingoutlineboholmembersmejonatandaanpopularizemartesfuelaccederconectadosiboninvestyumaonawalanghumanoscommunicationkiloarmedstreamingexitcosechasnanghihinamadadvertising,napapatungonaiyakpagdukwangnakuhakabundukandoble-karakanikanilangmagdamaganfactoressasakaynatinagemocioneskumalantogmakapagsabiunannatatanawhinagis