Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "figure"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Eh? Considered bang action figure si spongebob?

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

5. Ilalagay ko 'to sa mga action figure na collections ko.

6. Pull yourself together and let's figure out a solution to this problem.

7. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

8. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

9. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. It's important to maintain a good credit score for future financial opportunities.

2. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

3. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

4. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

5. Omelettes can be made using egg whites only for a healthier, lower-fat option.

6. El estudiante con el peinado raro está llamando la atención de sus compañeros.

7. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

8. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

9. Television has a long history, with the first television broadcasts dating back to the 1920s

10. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

11. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

12. Ano ho ang ginawa ng mga babae?

13. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

14. The team is working together smoothly, and so far so good.

15. Nakaupo ito, taas ang kaliwang paa, sa dulo ng halos dumapa nang bangko.

16. Masaya naman talaga sa lugar nila.

17. Gracias por todo, cuídate mucho y nos vemos pronto.

18. Ano ho ang nararamdaman niyo?

19. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

20. John Adams, the second president of the United States, served from 1797 to 1801.

21. She admired the way her grandmother handled difficult situations with grace.

22. You can't judge a book by its cover.

23. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

24. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

25. Mas maganda kung magbigay tayo ng oras at atensyon sa mga kabuluhan kaysa sa mga kababawan.

26. Kumusta? Ako si Pedro Santos.

27. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

28. The hiking trail offers absolutely breathtaking views of the mountains.

29. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

30. Cooking at home with fresh ingredients is an easy way to eat more healthily.

31. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

32. Tengo náuseas. (I feel nauseous.)

33. Murang-mura ang kamatis ngayon.

34. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

35. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

36. Nakahiga ako sa gabi nang biglang magkaroon ng malakas na kidlat at nagitla ako sa takot.

37. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

38. Bestida ang gusto kong bilhin.

39. A veces la realidad es dolorosa, pero no podemos escapar de ella.

40. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

41. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

42. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

43. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

44. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

45. They may draft and introduce bills or resolutions to address specific concerns or promote change.

46. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

47. Nakaupo ako nang matagal sa sinehan.

48. En invierno, las temperaturas suelen ser bajas y el clima es más fresco.

49. Tengo dolor de garganta. (I have a sore throat.)

50. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

Similar Words

figures

Recent Searches

figurededication,wallethydelkatapatsandalingngisikataganggawinlayuninsantosestáblessnerissamonetizingshowernagtagisantumatakboyunkaninongnagbasadolyarpatongendvidereundeniablejuiceengkantadalilyaksidenteunattendedtumulongmaibabalikiiklimaulitnatatanginghangaringbiglamaghapongerapdyandumaramiparatingmenutalagabuwenasincomerambutantagakbayabaspagtangisgagamitinkommunikerernagsulputanngunitkaninaespecializadasuwakdefinitivodreammungkahitiyakanmaya-mayapinilingsettingmahahawatumiraikinamatayhagdanankarapatangparusausurerosinoguerreroligapatuyoespigasleukemiainalokrolemamayamagtatamponightpangalanimaginationperamangangahoynagsasagotkelangancampaignsraisenaiilagankapamilyawingcornersnakangisingnamingseguridadmagtatanimisasamababaebansadaladalashowssharegethelpedhanginkailancasanagpuntaindustriyamag-ingatnewpasyasumabogkumantabitawanbinilingstudiedpagtatanghalnakabalikmaaksidentetumindigligayarosalaborhidingdon'tiphonenagkakatipun-tiponmusicianmagpapagupitlumamangnatatawananaisinbrasohinanaptamisdiwatabalitafulfillingnuhnagisingsinkartistsparkenoobuslosparepinakamasayapakpakfeedbacksumindisiguronakapaligidnagmakaawapanindanakikitangsasabihinpagtitiponmagisingumayoskilaydyosasikatibinalitangelectionhopetarcilaumulankasingtigasradiobiensorehamoneksamconcernsmarioinispilingfullsumibolipalinisnaaksidentesteamshipsmakatarungangnatapospaanongsumasayawhilingsuotrebolusyonmarangyanghumaboltrafficmakikiraancomunicanlosskauntinilulon