Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "figure"

1. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

2. Eh? Considered bang action figure si spongebob?

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

5. Ilalagay ko 'to sa mga action figure na collections ko.

6. Pull yourself together and let's figure out a solution to this problem.

7. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

8. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

9. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

Random Sentences

1. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

2. Ang bawa't isa ay may kanya-kanyang ginagawa.

3. They walk to the park every day.

4. There's no place like home.

5. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

6. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

7. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

8. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

9. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

10.

11. Saan ka kumuha ng pinamili mo niyan?

12. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

13. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

14. Mayroon kaming bahay sa Tagaytay.

15. Hinahanap ko si John.

16. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

17. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

18. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Estoy muy agradecido por tu amistad.

21. Está claro que la situación ha cambiado drásticamente.

22. Hindi na sila nasisiyahan sa nagiging asal ng bata.

23. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

24. Nakita niya ang isang magandang babae sa kaniyang harapan.

25. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

26. They have been studying for their exams for a week.

27. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

28. Ano ang pangalan ng babaeng buntis?

29. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

30. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

31. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

32. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

33. Nasa kuwarto po siya. Sino po sila?

34. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

35. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

36. Siguro ay may kotse ka na ngayon.

37. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

38. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

39. Las redes sociales son una parte fundamental de la cultura digital actual.

40. Nationalism can be both a positive force for unity and a negative force for division and conflict.

41. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

42. Ano ang nasa bag ni Cynthia?

43. Einstein was also an accomplished musician and played the violin throughout his life.

44. Naglalaway ako sa amoy ng niluluto mong adobo.

45. Pupunta si Mario sa tabing-dagat sa hapon.

46. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

47. Ilang araw ang reservation natin sa hotel?

48. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

49. They have won the championship three times.

50. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

Similar Words

figures

Recent Searches

orderbakebeginningtelevisedfigureelectronicdaratingstatusdideyecomuneswealthnagdiskonabigkasexampleefficientkapilingclassmateconsiderexplainwindowformatstartedstoplightwouldconstitutionbroadcastshimigapollomimosaultimatelytinderaarawpasigawfriesfinishedtabasmuliditobinabaaneveningcoaching:burdenbiggestheylabasriskprovejerrypodcasts,nagre-reviewmarketplacespinapakiramdamangayunpamankasalukuyanpagsasalitamakapangyarihangmedya-agwapagkakatayoampliapaksalegacybinatakponggiverwastenahihilomagbigayanadvancecarmenkindsdefinitivowaterimagesmalakasisinasamanaaksidentekaklasenalamankinalilibinganmagbibiladmaibibigayartistpagsahodmangahastaga-hiroshimanaapektuhankayabanganmensahemagpalagotanggalinnakangitisimbahanpagkuwapinakabatangeconomyglobalisasyonmagpalibrenapapatungopanghabambuhayibinubulongespecializadasnapatawagcarspinakamatabangfilipinamakakakaenkubyertostatayobagsaknawawalakabundukantumagaltatlumpungmiranagpuyosinilalabaslabing-siyamkumakainmahalgawaininaabotdadalawcardiganmaabutanganitohinihintaymagtagonamumulainterests,iniindadispositivotemperaturamamasyallikelydamdaminniyonnaglulusakparusahanrespektiveemocionesgatasliligawandiferentesbahagyakinakaindecreasedsurveysnagyayangpinansinpayongnatutuwabanlaglabahininiangatvegasmanonoodjolibeemalilimutanmagtanimemocionalmakatiandrealandassumpainestilosjobtalagamonumentopalibhasasinangisilayuanpatienttawanantayoibiliexperience,maingatasiaticamangproudkatapatsusipublishing,deletingsiglocubicleexpertiseinfluencesarkilalalakekumbentobumilipreskowalisfakemahiwagangsinampaltill