Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "styles"

1. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

2. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

3. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

4. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

5. His unique blend of musical styles

6. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

7. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

8. The clothing store has a variety of styles available, from casual to formal.

9. The film director produced a series of short films, experimenting with different styles and genres.

Random Sentences

1. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

2. Hendes hår er som silke. (Her hair is like silk.)

3. Isang babae na mahaba ang buhok na kulot, nakablue gown sya.

4. Bumili ako ng pasalubong sa tindahan kahapon.

5. Hindi dapat tayo magbulag-bulagan sa mga insidente ng abuso sa ating paligid.

6. Sarado ang eskuwela sa Sabado at Linggo.

7. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

8. Sa dapit-hapon, masarap mag-stroll sa mga kalye at maghanap ng masarap na kainan.

9. Dalhan ninyo ng prutas si lola.

10. The experience of bungee jumping was both terrifying and euphoric.

11. Børns leg og kreativitet er en vigtig del af deres udvikling.

12. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

13. Emphasis can also be used to create a sense of urgency or importance.

14. He has been working on the computer for hours.

15. The computer works perfectly.

16. My best friend and I share the same birthday.

17. Kasya kay Suzette ang blusang na ito.

18. Ang sigaw ng matandang babae.

19. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

20. Kumaliwa ka sa susunod na kanto.

21. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

22. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

23. Makikiligo siya sa shower room ng gym.

24. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

25. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

26. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

27. Malapit lamang pala ang pinaghatidan nito ng tubig.

28. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

29. Wag kang mag-alala.

30. Hindi pa namin napapag-usapan eh. sagot niya.

31. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

32. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

33. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

34. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

35. May isa pang nagpapaigib sa kanya.

36. Binentahan ni Aling Maria ng prutas si Katie.

37. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

38.

39. He is typing on his computer.

40. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

41. Sumasakay ako ng taksi sa umaga araw-araw.

42. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

43. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

44. Good things come to those who wait.

45. Pero mukha naman ho akong Pilipino.

46. Magandang umaga po. ani Maico.

47. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

48. Iyong kulay itim na bag ang bag ko.

49. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

50. Einstein's work led to the development of technologies such as nuclear power and GPS.

Recent Searches

stylesnagbanggaanikinatatakotmagsalitagulatclubkinapanayampagkamanghamakikipaglaroamericahulumatagpuanpinag-aralanpresence,nagpakunotmaghihintaynaglaoniiwasandiyanmaglaronearnasagutannakilalaopisinavotesenviarmaghahabipananakittiniklinghistoriaattorneygarbansossementeryopatingjagiyakamotekaniyamahigitnanigasnuevosnauwinenainvitationtssstusindvisuncheckediniisiptransportationmayabangmalakibumigaytamasumandalmataanubayannagtatampokinausappuedennasulyapansurgeryagilitymagbungasinabi10thsumarapkailanganworkdayledstandetodumatingeksenaprocesscallingnutsskillumuwibeyondrawattentionitinuringminu-minutomaunawaanreceptorpyschemalaboconectadosnahawaipinatutupadmataasbansajosephlumakadsanibabawmagtiismatagumpaynagsabaybabesinoinalokbarkokidkirantumiraclassesdulllandmarionagbababamagasawangikinamataydadalhinnaglalatangpaghihingalokayang-kayangmagpagalinghinatidmagtatanimkinakabahano-onlinenapalitangunahinnapapasayatagaytayhayaanspanagkasunogalikabukinlumipadmoviepinasalamatanpersonaskapintasangmangangahoykalayuantravelernagtalunanpagkaawataga-ochandokatiekilongkamandagnakumbinsikristoininomawitanbarrerasmagpakaramikailanmantrentapinauwiamendmentskasuutanbutopatongrightsnangingitngitjuliettusongmagbibiyahelotsemillasmeansyatananaymeronganitokasoyneedsmegetreservedspentnatanggaplegislationomgayanlintanagbasaimpitbitawandonbrideataquesdahonelectioncomplicatedataamendmentmakatimapmessagemediummitigateandreincreasedformsnakaraangmakakaineskuwelahannangyari