Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "metode"

1. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

Random Sentences

1. Pwede ba akong pumunta sa banyo?

2. Ini sangat enak! - This is very delicious!

3. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

4. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

5. El actor hizo un comentario controversial que está llamando la atención de los medios.

6. Walang sinumang nakakaalam, sagot ng matanda.

7. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

8. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

9. Ang mommy ko ay masipag.

10. Tuwing gabi, ang mga tao ay nagpapahinga at natutulog upang mag-refresh ang kanilang katawan at isip.

11. Television has also had a profound impact on advertising

12. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

13. Wala ka na bang iba pang gustong puntahan?

14. They are shopping at the mall.

15. Niluto nina Tony ang isda sa kusina.

16. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

17. Sa dapit-hapon, masarap tumambay sa beach at mag-enjoy sa tubig.

18. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

19. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

20. Paboritong laro ng kuya ko ang basketbol.

21. Kanser ang ikinamatay ng asawa niya.

22. Wala akong pakelam, basta nasa ref ng bahay ko akin!

23. Ano ang natanggap ni Tonette?

24. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

25. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

26. Magandang araw, sana pwede ba kita makilala?

27. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

28. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

29. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

30. Ailments can be managed through self-care practices, such as meditation or physical therapy.

31. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

32. She draws pictures in her notebook.

33. Hindi mo na kailangan ang magtago't mahiya.

34. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

35. Kucing di Indonesia sering dimanjakan dengan mainan seperti bola karet atau mainan berbentuk tikus.

36. Hinagud-hagod niya ang mga kamao.

37. Napakalakas ng kanyang halinghing dahil sa sobrang kalungkutan.

38. Ang pangalan niya ay Mang Sanas.

39. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

40. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

41. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

42. Mahusay mag drawing si John.

43. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

44. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

45. In this industry, singers who can't write their own songs are a dime a dozen.

46. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

47. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

48. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

49. At følge sin samvittighed kan nogle gange kræve mod og styrke.

50. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

Similar Words

metoder

Recent Searches

metodenakabilitaostagetradisyonmagdalaibonperacantosquattereroplanotumamabilibidumalistuyongtinaasanmakauuwimag-orderfauxhospitalfiancebutihingtamadspecificbilaouponmaaamongnami-misssubalitvocalbinatangmadadalastyrercountlessdyiplayuninmagpapabunotbobotooperatedatabosskinagalitandaratingpaaralanpag-asapagpdadelstudiedmalapitanmagtiishateuwilubosganyangusgusingkuwebafoundkarununganbungadarnamagitingyoungnamamsyaltuvogospeldesarrollarontanggapinlagnatbaduykalanupangslavededication,tumagalstylemarilouqualitynakikitangmagkakaanaknamanjagiyanagpapakinistumingaladuguanprinsipelayasduminaglalarodiretsahangmagtanimpagdiriwangbigaspersonspinalayasnapakabutiourmakulitmaaaringkaliwainiuwibiyasisasagotibinubulongdadalohumingamaulinigannakatunghayblusahatinggabidagatseniormasyadonagdudumalingpinagawasikobiyayangmakikipag-duetoclimabisitamakakatakastonettepedengnanagnapasukogiyeratoribiopunong-punoapelyidoahasdentistanagpapaypayaeroplanes-allskyldeslumbaynewspapersreadpumansinnag-uumiripatience,pagka-diwatamabuhaylikodbuwenasbuwanmakapagsalitawhiletermbinilhantelangnaglulusaktrapikalmusalpinagtagpoanyosantosnakakapamasyalpanalanginmag-aaralinakyatlarawanracialduonipinambilitrabajarkamamakatarungangbranchesdooninakahirapaniikotpalipat-lipatenfermedadesnag-iisanilaoscentercomputerehelloforskel,diaperlotcommunicationekonomiyamag-inaadikyou,noohighstevemagbubungacommercialrestaurantromanticismoniyaplatformitsurajolibeekasamahanpinagkiskis