Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "labor"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

Random Sentences

1. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

2. The event was sold out, and therefore we couldn't get tickets.

3. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

4. Ang tugtugin ay may mababa ngunit malalim na tono.

5. Kakain ako ng spaghetti mamayang gabi.

6. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

7. Dahil sa magigiting nating bayani, nakamit natin ang araw ng kalayaan.

8. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

9. Ang salarin ay nagtago sa malalayong lugar upang makaiwas sa pag-aresto.

10. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

11. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

12. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

13. The flowers are blooming in the garden.

14. Mabuti na lamang ay sinunod nya ang alituntunin ng kanilang paaralan.

15. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

16. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

17. Ang daming bawal sa mundo.

18. A couple of coworkers joined me for lunch at the cafe.

19. Television has also had an impact on education

20. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

21. Elektronikken i en flyvemaskine kan hjælpe med at overvåge flyvningen og opretholde sikkerhed.

22. The dog does not like to take baths.

23. Ang gobyerno ay naglaan ng tulong para sa mga apektado ng tagtuyot.

24. Bigyan mo ng pera ang kapatid mo.

25. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

26. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

27. Magkano ang isang kilo ng mangga?

28. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

29. Good morning din. walang ganang sagot ko.

30. El autorretrato es un género popular en la pintura.

31. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

32. Dumating ang pangulo sa pagtitipon.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

35. Las labradoras son una raza de perros muy populares en todo el mundo.

36. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

37. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

38. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

39. This can generate passive income for you, but it does require some capital to get started

40. The website's analytics show that the majority of its users are located in North America.

41. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

42. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

43. Lumalangoy ako kapag nasa tabingdagat kami.

44. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

45. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

46. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

47. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

48. The company suffered from the actions of a culprit who leaked confidential information.

49. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

50. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

Recent Searches

abilaborateitimtopic,bulsahelpfulstudentcolourfiststrackconventionalourleeabstainingstonehamwalletbeintemuchoscomparteneasiertekstlamesamaitimcongressipanlinisulambilincommunitydollyindiamaulitpumatolbarnesandamingtelangroommalapadipantaloplawsiskopierclientspagpasensyahanvirksomhedersilbingwalngnewnaunapinalakingpopulationjoydaigdiglibrarykagayaskillsuedeanothergotumarawpointconsiderarnagdaospataymetodelaranganlalongsundaloprimerasthroughoutwingnanaogfarpuedennahulognasasaktangraduationmagbigayanbulalassegundodelengipinkumpunihinniyansayantokcoachingkaratulanglikodnabighanipagkagustotuwingbangkangnakabaondenconstantmakikipagbabagtinaastoolyataroofstockfionaantonionunoargueinulit1954treatsgagawinmagbayaderlindanahawakanpagkaimpaktopagkakamalinalalamanmanatilireserbasyonlumakinaliwanaganpresentapinagawaseparationmawawalaclassroomrepublicannagkaganitomagkaparehomasaksihandaramdaminumiinomibinibigaysaranggolabalitatinutoppagsalakayhealthierpinag-aaralanpakibigyankagandahagkabutihankapamilyamagpakasalnakangisinagsimulasiguronaglahongdemocraticnakaumigtadrosetitasumamamaliittulisanmabagaldapit-haponkampeonpowerspagguhitrenacentistalumabaspictureshinihilingnanunuksomahabangpagkagisingtumamatindatinahakliligawanapatnapuna-fundpapayanilaosnakauslinggawaingsalaminaustraliaisinusuotbiyernestransportumabotnagplayhinugotpananakitsandwichcantidadnag-uwitatlomaramotminahanhinukaysinamahigpitsikipgodtquarantinesacrificeutilizarbinatak