Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "take"

1. All these years, I have been learning to appreciate the present moment and not take life for granted.

2. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

3. Eating healthy is an important way to take care of your body and improve your quality of life.

4. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

5. Goodevening sir, may I take your order now?

6. He's always telling tall tales, so take his stories with a grain of salt.

7. He's known to exaggerate, so take what he says with a grain of salt.

8. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

9. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

10. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

11. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

12. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

13. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

14. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

15. Money can take many forms, including cash, bank deposits, and digital currencies.

16. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

17. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

18. Politics in America refers to the political system and processes that take place in the United States of America

19. She's always gossiping, so take what she says with a grain of salt.

20. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

21. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

22. That article might not be completely accurate, so take it with a grain of salt.

23. The bridge was closed, and therefore we had to take a detour.

24. The cat was sick, and therefore we had to take it to the vet.

25. The dog does not like to take baths.

26. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

27. The information might be outdated, so take it with a grain of salt and check for more recent sources.

28. The lightweight design of the tent made it easy to set up and take down during camping trips.

29. The news might be biased, so take it with a grain of salt and do your own research.

30. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

31. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

32. The reviews aren't always reliable, so take them with a grain of salt.

33. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

Random Sentences

1. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

2.

3. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

4. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

5. Hindi maganda ang resulta ng ginawang pag susulit ni Mikaela.

6. Laging may buslo ng bulak sa tabi ang lola, at isang mahabang patpat na kidkiran (huso, spindle) ng sinulid.

7. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

8. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

9. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

10. All these years, I have been working hard to achieve my dreams.

11. Morgenstund hat Gold im Mund.

12. At have håb om, at tingene vil ordne sig, kan hjælpe os med at se lyset i slutningen af tunnelen.

13. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

14. Upang hindi makalimot, laging may sticky notes ang malilimutin na si Bea.

15. Ang paggamit ng droga ay maaaring magdulot ng pagkawala ng trabaho, pamilya, at mga kaibigan dahil sa mga problemang may kinalaman sa droga.

16. Nagsusulat ako ng mga kasunduan at kontrata bilang abugado.

17. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

18. Maari mo ba akong iguhit?

19. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

20.

21. Hallo! - Hello!

22.

23. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

24. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

25. Gusto mong mapabuti ang iyong kasanayan? Kung gayon, magpraktis ka araw-araw.

26. Sa droga, walang kasiguraduhan kundi kamatayan.

27. Madalas ka bang uminom ng alak?

28. A quien madruga, Dios le ayuda. - The early bird catches the worm.

29. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

32. Ayos lang. Basta alam kong safe kang nakauwi.

33. Humingi ng tulong ang magsasaka sa albularyo dahil naniniwala siyang may kulam sa kanyang hayop.

34. She has been making jewelry for years.

35. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

36. Napakaganda ng bansang Pilipinas.

37. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

38. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

39. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

40. Libre ba si Carol sa Martes ng gabi?

41. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

42. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

43. Kung mababatid lang ng mga tagaroon ang katotohanan, marahil hindi na sila magtataka kung bakit namumukod-tangi ang kagandahan nina Lala, Dada at Sasa.

44. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

45. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

46. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

47. A couple of minutes were left before the deadline to submit the report.

48. We celebrated their promotion with a champagne toast and a slice of cake.

49. Kapag sumabog ang mga salot ng droga, hindi lamang ang tao ang nasasaktan, pati na rin ang buong pamilya.

50. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

Similar Words

inataketakes

Recent Searches

takepreviouslyhahahaadvancementrestawannapahintobugtongspeechkapeteryaofferexplainpublishedlumulusobmakahirammakakabalikkalayuanwalkie-talkiepayonalulungkotsandoklumiitevnesimbahanmagbakasyonsamakatwidartificialcardiganpakialamaddictionpagtangispedroprinsipepagkamanghahelloiskedyulunconstitutionalginhawaeksaytedsinapaknagpagupitmahabangnakisakayquarantinesarilisponsorships,teknologipinagtagponapipilitanlumangnakauwiluneshomesniyansorryumiibigpinagbigyanmournedtekstpaghangacorporationpresence,nakataassisidlanpackagingmatalinonobodymasayahinpinag-aralansusisingermayabanglamigdomingomapaibabawnatuyotravelpasswordbobotonagreklamomuranganihinapologeticbumigaymaipapautangknowngownaga-agalargenahulogsinumangsinusuklalyanimprovelikescoachingtaposnaglahonaghuhumindigpunong-kahoybaldetinitindamakescarlobinabalikdedicationuniquemenululusogdumilimcallinghiningatargetmaestroalinpaaralanmalulungkotpagdudugoconnectingcountlessmovingnotebookayudabituinpanamamabagalhinawakanhubad-baromakapagsalitamaongnagsulputannaturalgumigitisobrangnag-isippinatirakainbrainlyinitpalibhasalavdikyamdivisoriabakasyonmatutuwahuertodiliginmaramotpintohenryrememberedtuvoerlindainumineeeehhhhkubowordsallowspinakamaartengpag-aapuhapnasahodyouthmallriyanpananglawcentermedisinascalepamburaunosmasasamang-loobtinanggalvitaminmasaktannovemberbarnesctileslumipatnakakatulongnewskinatatakutanellafluiditynapuyatnakakapagpatibaypatawarinprosesoochandopagbigyan18thtumakaswashingtonnakakatabaambaginventionniligawansandaliberegningermaasimdisfrutarworrygusting-gusto