Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "take"

1. All these years, I have been learning to appreciate the present moment and not take life for granted.

2. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

3. Eating healthy is an important way to take care of your body and improve your quality of life.

4. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

5. Goodevening sir, may I take your order now?

6. He's always telling tall tales, so take his stories with a grain of salt.

7. He's known to exaggerate, so take what he says with a grain of salt.

8. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

9. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

10. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

11. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

12. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

13. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

14. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

15. Money can take many forms, including cash, bank deposits, and digital currencies.

16. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

17. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

18. Politics in America refers to the political system and processes that take place in the United States of America

19. She's always gossiping, so take what she says with a grain of salt.

20. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

21. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

22. That article might not be completely accurate, so take it with a grain of salt.

23. The bridge was closed, and therefore we had to take a detour.

24. The cat was sick, and therefore we had to take it to the vet.

25. The dog does not like to take baths.

26. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

27. The information might be outdated, so take it with a grain of salt and check for more recent sources.

28. The lightweight design of the tent made it easy to set up and take down during camping trips.

29. The news might be biased, so take it with a grain of salt and do your own research.

30. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

31. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

32. The reviews aren't always reliable, so take them with a grain of salt.

33. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

Random Sentences

1. Te agradezco por estar siempre ahí para mí.

2. Nahihirapan ka na siguro.. sorry.

3. Ayan sasamahan ka na daw ni Kenji.

4. Smoking can be addictive due to the nicotine content in tobacco products.

5. Wala ka namang dapat ipag-alala. Kaya ko ang sarili ko.

6. Pakibigay ng pagkain sa mga alagang hayop bago ka umalis ng bahay.

7. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

8. Kumain na kami ng tanghalian kanina.

9. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

10. Napakamot na lang ng ulo si Kenji.

11. Tinanong ko ang kapitbahay kung puwede kong hiramin ang kanilang lawnmower.

12. The city installed new lights to better manage pedestrian traffic at busy intersections.

13. Huwag masyado magpaniwala sa mga nababasa sa internet.

14. Sa daan pa lamang, bago siya pumasok ng tarangkahan, ay natatanaw na niya ang kanyang anak na dalaga na nakapamintana sa kanilang barung-barong.

15. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

16. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

17. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

18. Menjaga kesehatan fisik dan mental juga berperan penting dalam mencapai kebahagiaan yang berkelanjutan.

19. Bakit sumakit ang tiyan ni Tonyo?

20. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

21. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

22. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

23. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

24. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

25. Oh di nga? Nasaang ospital daw?

26. Ang bango ng kape sa umaga ay nagbibigay ng mabuting simula sa araw.

27. My daughter made me a homemade card that said "happy birthday, Mom!"

28. Natutuwa ako sa balitang iyan mahal ko.

29. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

32. It's important to maintain a good credit score for future financial opportunities.

33. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

34. Dapat niyo akong pagsilbihan dahil dito.

35. May gamot ka ba para sa nagtatae?

36. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

37. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

38. Después de la lluvia, el sol sale y el cielo se ve más claro.

39. Dadalaw ako kay Lola Sela bukas.

40. Binigyan ng pangalan ng Apolinario Mabini ang isang bayan sa Batangas.

41. Tak ada gading yang tak retak.

42. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

43. Nasan ka ba talaga?

44. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

45. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

46. Na ikaw ay isang musmos lang na wala pang alam.

47. Teka, pakainin na muna natin sila. ani Jace.

48. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

49. En tung samvittighed kan være en kilde til stor stress og angst.

50. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

Similar Words

inataketakes

Recent Searches

resulttakebumabafriesmacadamianagpakitamagkaibangnapagtantobwahahahahahanagtitindamatayogpakiramdamsigatsuperbunsomaisipdesarrollarkaano-anoeffektivmedievalpangambamapahamakbaocallermahabamajorsalapiilingnangapatdanthreeellenpokerginamitmadungisassociationinirapanmakakawawakagandahankalakimagtiwalalikuranpinipilitnananalopulubiadvancedpoorerkapamilyakwartonakaimbakoverallgatherfactoreskapalre-reviewinnovationawitanalleevolvedaddressgamotmartialobstaclescompositorespisaramultomayatinawananpagkuwantiistumambadinformationpagkabatabihasanahawapuwedengpaulmansanaseuphoricmagsasakastarnagnakawmirapamanhikansasayawinbaranggaypakanta-kantangkumakalansingmabibingiumokayhalinglingtalagangumiwasnabigkasnasunogtinataluntonmangkukulamflyvemaskinersasamahanlumikhakare-karekahaponturismojansagotpinakamatapatlumalangoygeologi,nakabulagtangnagsisipag-uwianuulamininilistapumilinagsmileinakalatumalimmagbibigaymagbantaymagalangproductividaddiwatatumahanpagkatakotmawawalamakakakaenmatumalganapinnaiinisiniuwimagawamauupogospelpasyalankamaybinentahanniyogsumaboglinamatulunginengkantadaendvideresikatbumahakauntinagwikanggumisingsapatkasaysayannakinigninyokuwebasapotejecutanmabutinaturalpagkatlasalarangannandiyanmeriendanatulakhinintayboholchoiangkanhopematuliskaugnayanmataraymakasahodmaramingdreamssufferknownweddingreboundinomresortbumabahanakuhojas,bokpayipagamotbroughttonpedrocryptocurrency:corporationmanuksojamescommunicationnerodesdetomarmarchdyandumaramiprocesshellosmall