Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "take"

1. All these years, I have been learning to appreciate the present moment and not take life for granted.

2. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

3. Eating healthy is an important way to take care of your body and improve your quality of life.

4. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

5. Goodevening sir, may I take your order now?

6. He's always telling tall tales, so take his stories with a grain of salt.

7. He's known to exaggerate, so take what he says with a grain of salt.

8. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

9. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

10. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

11. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

12. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

13. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

14. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

15. Money can take many forms, including cash, bank deposits, and digital currencies.

16. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

17. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

18. Politics in America refers to the political system and processes that take place in the United States of America

19. She's always gossiping, so take what she says with a grain of salt.

20. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

21. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

22. That article might not be completely accurate, so take it with a grain of salt.

23. The bridge was closed, and therefore we had to take a detour.

24. The cat was sick, and therefore we had to take it to the vet.

25. The dog does not like to take baths.

26. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

27. The information might be outdated, so take it with a grain of salt and check for more recent sources.

28. The lightweight design of the tent made it easy to set up and take down during camping trips.

29. The news might be biased, so take it with a grain of salt and do your own research.

30. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

31. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

32. The reviews aren't always reliable, so take them with a grain of salt.

33. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

Random Sentences

1. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

2. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

3. Isang tanod ang dumating at sinabing may dalaw si Tony

4. Ang agila ang pambansang ibon ng Pilipinas.

5. A latte is a popular espresso-based drink that is made with steamed milk.

6. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

7. Ibinabaon ng magnanakaw ang kanyang ninakaw na yaman sa ilalim ng puno.

8. Mula pagkabata ay naging magkaibigan na si Lando at Maria.

9. May mga pagkakataon na naisip niyang may kailangan siyang bilhin sa grocery store, pero pagdating niya roon, bigla niyang nalimutan kung ano iyon.

10. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. Drømme kan inspirere os til at tage risici og prøve nye ting.

13. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

14. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

15. Masyado ka naman nagpapaniwala kay Andrew!

16. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

17. Libag ang tawag sa duming kumakapit sa katawan na karaniwang galing sa alikabok

18. Cooking at home with fresh ingredients is an easy way to eat more healthily.

19. Doa bisa dilakukan secara individu atau bersama-sama dengan orang lain.

20. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

21. Kakain ako sa kapeterya mamayang tanghali.

22. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

23. Haha! I'd want to see you fall inlove tonight.

24. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

25. Ikinuwento niya ang nangyari kay Aling Pising.

26. Umuuwi siya sa probinsiya linggo-linggo.

27. Nakarating na kami sa aming pupuntahan.

28. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

29. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

30. Tumawag ako kaninang umaga pero wala ka.

31. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

32. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

33. Disyembre ang paborito kong buwan.

34. A wife can be a source of emotional and physical intimacy for her husband.

35. A couple of hours passed by as I got lost in a good book.

36. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

37. Ano ang ginagawa ni Trina tuwing Mayo?

38. If you think he'll lend you money, you're barking up the wrong tree.

39. Nasa Cebu si Trina sa Disyempre?

40. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

41. Nagtawanan ang mga kaibigan, waring may alam silang lihim na hindi ko nalalaman.

42. Kailangan nating bigyan ng tamang suporta at pag-unawa ang mga taong madalas mangiyak-ngiyak upang matulungan silang lumampas sa kanilang pinagdadaanan.

43. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

44. It was founded in 2012 by Rocket Internet.

45. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

46. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

47. The patient's family history of leukemia increased their risk of developing the disease.

48. Gandahan mo ang ngiti mo mamaya.

49. Ang lilim ng kanyang mga braso ay nagbigay ng komportableng yakap sa kanyang mga apo.

50. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

Similar Words

inataketakes

Recent Searches

taketextounoshapingcoaching:muliumiilingyannag-aaralelektronikprovekenjipaydyanguardaboktanimnambroughtboyhatingdancechefdingginaidgamitdidingnapakolagunadecreasesourceneedsinternaldumaramiblendbalitaparatingthingsinumanserpagsalakaynapaluhadadalawinganidbabasulinganvidtstraktpesopaghuhugasmatalikmagsasalitakasintahanapatnapumarahilmatatagmuchaswaykalyedawlikepasensiyakakaroonkaninapinapanoodhalamanghulirealisticnahulibusiness,naintindihanviewpinabulaanaddkaninangpaliparinmabigyannutrientesnetorebolusyoncigaretteslandasfallakasikastilaipinikitprusisyonpedemapequipobastaspaghettiworrypyestacharmingguestssoonlegislativefauxzooleadingdibaibinalitangkarangalaninangjosephmantikaadvancementgumigisingtinanggalpaulit-ulitiiwasannangapatdannangahasfreeiniinombigotekrusindustrybingigranadadyosasandwichincrediblemagalitkilaynapawibarrerasnalalabisalemamanhikanmakikipaglaronagtutulaknagmamaktolmaliksihinimas-himaspagkabuhaymagpagalingpaghihingaloeconomynakapaligidsalbahengmakaraanpagtawakumidlatpinapalonaibibigaynakakadalawpasosnanghihinamadnakakitamagsalitakagandahannakabibingingnakahainbowlmasyadongmakapagempakepinigilanmamalasmatigasmakinangwifiofrecenmaliitdefinitivolilikopakaininmoodkalanmightcomienzanrailwaysfuelpopularizeefficientbackautomaticawarepasinghalimpitkalayaanmahalinfullmonetizingyonvasquesoftetwinklelugarmusmoskahonsalubongmatindingsegundoheartbeatkumatokitakunderholderbitbitgiyera