Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "right"

1. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

2. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

3. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

4. I am not listening to music right now.

5. I am reading a book right now.

6. I don't want to cut corners on this project - let's do it right the first time.

7. I forgot your birthday, but here's a card anyway. Better late than never, right?

8. I know I should have apologized sooner, but better late than never, right?

9. I know I should have started studying earlier, but better late than never, right?

10. I know I'm late, but better late than never, right?

11. I know things are difficult right now, but hang in there - it will get better.

12. May I know your name so we can start off on the right foot?

13. Napag desisyonan ko na. Love is sacrifice, right?

14. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

15. She is not studying right now.

16. The queen consort is the wife of the king, while the queen regnant is a female monarch in her own right.

17. They are not shopping at the mall right now.

18. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

2. Ilang kilo ng pinya ang binili niya?

3. Different types of work require different skills, education, and training.

4. May pitong taon na si Kano.

5. We need to reassess the value of our acquired assets.

6. Nakakain ka na ba ng prutas na durian?

7. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

8. Halika, i-recharge natin ang baterya mo.

9. Effective use of emphasis can enhance the power and impact of communication.

10. The patient's family history of high blood pressure increased his risk of developing the condition.

11. Hindi mo inaasahan na ang simple at normal na araw ay maaaring magdulot ng agaw-buhay na pangyayari.

12.

13. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

14. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

15. Some ailments are preventable through vaccinations, such as measles or polio.

16. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

17. Las comidas calientes y reconfortantes, como sopas y guisos, son populares en invierno.

18. Kasi ho, maraming dapat kumpunihin sa bahay.

19. The United States has a system of government based on the principles of democracy and constitutionalism.

20. Kumain ako ng sinigang sa restawran.

21. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

22. Te agradezco por estar siempre ahí para mí.

23. Kawah Ijen di Jawa Timur adalah tempat wisata populer untuk melihat api biru yang terlihat di dalam kawah gunung berapi.

24. Nakaakma ang mga bisig.

25. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

26. Twitter was launched in 2006 by Jack Dorsey, Biz Stone, and Evan Williams.

27. Con permiso ¿Puedo pasar?

28. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

29. Mahusay siya sa komunikasyon at liderato, samakatuwid, siya ang nahirang na bagong presidente ng organisasyon.

30. El arte es una forma de expresión humana.

31. Writing a book is a long process and requires a lot of dedication and hard work

32. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

33. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

34. Tuwing Marso hanggang Hunyo ang summer break

35. Pinagsulat si Jayson ng pangungusap sa pisara.

36. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

37. Kanino makikipaglaro si Marilou?

38. Terima kasih. - Thank you.

39. Masyadong mahal ang kanyang gustong bilhin, samakatuwid, naghanap siya ng mas murang alternatibo.

40. Ikinagagalak kong makita kang masaya sa bagong kabanata ng iyong buhay.

41. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

42. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

43. Omelettes are a popular choice for those following a low-carb or high-protein diet.

44. Malapit na ang araw ng kalayaan.

45. La paciencia nos da la fortaleza para seguir adelante.

46. La arquitectura de la catedral es sublime, con sus detalles ornamentales y grandiosidad.

47. The car broke down, and therefore we had to call for roadside assistance.

48. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

49. Maaari po bang makahingi ng sobra sa hapunan ninyo?

50. Ano ang ikinamatay ng asawa niya?

Similar Words

brightRights

Recent Searches

daddyrightnegativelalargaenchantedfeedbackhalosdeclareannaextrahapdineverconditionadaptabilityelectayanbroadcastingsetsgenerabacountlessmalungkotnapadpadsusulitmalinismahiwagapapalapitadicionaleskongbakitmejotahimiklilypamagatmaistmicaculturespakiramdammag-ingatinakyatchessnahuhumalingsiganaggalakaramihannagsisunodestablishedbetweenduraslegislationhagdanankulunganrecordedpagpalithojaserlindalibraryprusisyondinaluhanpagpapasansimbahanpagbatibumagsakailmentsdisfrutarbwahahahahahakinatatakutankapangyarihangsisentautilizakonsultasyonmuladyipnatulogi-googlepresleykuwentoiyondatingpamburahayaangbagkusdahan-dahanmissionheartbreakexpressionsubod18thtinapaytumamisdealprovidedbecomeguitarramandirigmanginuminpeteraninicemagpuntaleadersproductividadnandayabisitakahuluganpansamantalapakakatandaanmaghahatidtumatanglawmasaksihanmananakawtitakatuwaanmabihisansellnakilalaevolucionadonahigitanmaraminaaksidentebyggetmagtataniminuulamintensidadpacienciamahinognakahugnapapansinnapalitanghimihiyawpagdamikainansakaytangantagsibollilikoduwendenapakanilayuanbibigyanpalayobiyernestagalkanilalumbaykumikilosnapasigawbayawaknaabutanmakakakaenmagagawakalayuanpagkagustonagmistulangestudyantenakayukonaibibigaypaanongmatangumpayterminopapagalitankasangkapanpaga-alalamangangahoynagtutulaktaga-nayontravelermanamis-namisiintayinnakamitbatokpinapasayamaliksiunti-untidisenyongnamumulotalas-diyeslumiwagnagmamadalipamamasyalnagsasagotpapanhikmamanhikaneskwelahanhawakpwestopinansinnatanongsisikattog,hayoptelecomunicacionesmilyonglumusobmamuhayapelyidomabagalginawaranhahahaseryosongtamaraw