Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "advertising"

1. Before television, most advertising was done through print media, such as newspapers and magazines

2. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

3. Emphasis is often used in advertising and marketing to draw attention to products or services.

4. Facebook offers targeted advertising options for businesses and organizations to reach specific audiences.

5. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

6. Television has also had a profound impact on advertising

7. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

8. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Iparating mo ang mensahe sa mahal na hari.

2. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

3. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

4. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

5. Sa dakong huli ng aking buhay, sana ay masabi ko na nagawa ko ang lahat ng gusto kong gawin.

6. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

7. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

8. A wife is a female partner in a marital relationship.

9. Masyado siyang tulala sa kanyang pangarap at hindi na niya napapansin ang totoong mundo.

10.

11. Viruses are small, infectious agents that can infect cells and cause diseases.

12. Kailangan nating magsumikap upang makamit ang ating mga pangarap.

13. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

14. Napakaganda ng mga pasyalan sa bansang Singapore.

15. I have been studying English for two hours.

16. Magkano ang isang kilo ng mangga?

17. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

18. Binisita ako ng aking kaibigan na matagal ko nang hindi nakita kaya masayang-masaya ako ngayon.

19. Balak po naming bumalik sa susunod na linggo.

20. The acquired assets will improve the company's financial performance.

21. Pakidalhan mo ng prutas si Lola.

22. Sinong may sabi? hamon niya sa akin.

23. The invention of the telephone led to the creation of the first radio dramas and comedies

24. Les universités offrent des programmes d'études en ligne pour les étudiants à distance.

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

27. He has improved his English skills.

28. Haha! Bad mood na bad mood ka ah?

29. Laughter is the best medicine.

30. Mahalagang regular na magpatingin sa dentista upang maiwasan ang mga dental problem.

31. En invierno, los días son más cortos y las noches son más largas.

32. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

33. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

34. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

35. Hindi naman siya masyadong maarte pero ayaw niya ng mga gusot sa kanyang mga damit.

36. Protecting the environment involves preserving natural resources and reducing waste.

37. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

38. Si Andres Bonifacio ay isang magiting na bayani.

39. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

40. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

41. Necesito ver a un médico. (I need to see a doctor.)

42. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

43. Tahimik ang kanilang nayon.

44. Lumipad ang binatang naging kulisap upang hanapin ang babaeng mas maganda pa kaysa sa engkantada.

45. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

46. Ang mga magulang ay dapat maging maingat sa pagbabantay sa kanilang mga anak upang maiwasan ang paggamit ng droga.

47. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

48. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

49. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

50. The musician released a series of singles, leading up to the release of her album.

Similar Words

advertising,

Recent Searches

advertisingmaligayareservedelectionsconvertidasbilhinsoreownbayanhaltmakatinapagtantomag-uusapmoodmarketingpatientemphasizedpuwedepalengkenagdiriwangnangangahoynaliligopositibonaiinggitaidgiyeraninyongpinamumunuanlalabasinaaminhorsepagpasokdesarrollaronroquemaynilamakitangdumaanpramisnaglabananreviewerspasensiyaenfermedades,pagpilipagkalitomalihispinagsikapannag-replynalalabingmakitamarmaingdevicesarkilakakayanankainannagpatuloyrimasestadosbarcelonamaglinisnaguguluhangdescargarnag-iisapagsumamonabalitaanmakakasahodnagbakasyonpamumunonakapasabusinessespagsisisidahan-dahannagawangtugonnabasasalatinhabittamadtayongipingkuboprutassumagotkelanalayfulfillingkumatokmakapangyarihangmedya-agwanakapagngangalitculturanakakapagpatibaydamitkinatitirikanbritishfranciscotinanongmiyerkulesnegrosenviarmanahimiktaglagasdisciplinpabilikagabimanakboiligtasnabigyanpalamutianaautomationorganizetssstamiswaitergymmanuscriptbinulabogmariopopcornmag-anakhidingvidenskabvehicleslandopagsayaddangerousspeedmillions1973thenanimobabesumindiwayslamesareloobstaclescigarettenaroonstatushabamakapilingsolidifypatrickwaitexplainjohnpointumarawkumembut-kembotgubatbutobalediktoryanjackymiyerkolespiecesnangyaringikinatuwatinanggaltagumpayginainabotsumamalungkotledfireworksimikthroughhinampasbagyojocelynlalakengpulisdisappointpagbabantalackpasswordshopeelingidmaiseducativasproductionlendingsolarpisodependingaddingconstitutionmaratingregularmenteelectronicbabalumiwagagam-agamnagmamadalibibisitakalakihannakumbinsitanyagbranch