Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "process"

1. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

2. Congress are elected every two years in a process known as a midterm election

3. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

4. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

5. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

6. Frustration can be a normal part of the learning process and can lead to personal growth and development.

7. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

8. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

9. Investing refers to the process of allocating resources with the expectation of generating a profit.

10. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

11. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

12. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

13. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

14. The President is elected every four years through a process known as the presidential election

15. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

16. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

17. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

18. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

2. May nakita ka bang maganda? O kabigha bighani?

3. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

4. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

5. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

6. Marahil ay mahirap para sa akin na magpasya sa ngayon.

7. Sa harapan niya piniling magdaan.

8. Their primary responsibility is to voice the opinions and needs of their constituents.

9. No hay que perder la paciencia ante las adversidades.

10. The new factory was built with the acquired assets.

11. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

12. Emphasis can be used to provide clarity and direction in writing.

13. Wala dito ang kapatid kong lalaki.

14. Leonardo da Vinci trabajó para los Médici en Florencia.

15. Hindi pa ako naliligo.

16. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

17. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

18. She wakes up early every morning to exercise because she believes the early bird gets the worm.

19. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

20. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

21. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

22. Napakasipag ng aming presidente.

23. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

24. Pasasaan ba't di iikli ang pila? naisip niya.

25. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

26. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

27. Le jeu est une forme de divertissement dans laquelle on mise de l'argent sur un événement aléatoire.

28. Ang kaniyang dugo ay nakakagaling ng mga sakit.

29. Les enfants ont des besoins de santé particuliers qui doivent être pris en compte.

30. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

31. ¡Claro que sí, acepto tu invitación!

32. Nang biglang lumindol at nawala ang matabang babae, isang diwatang ubod ng ganda ang lumitaw sa harap niya.

33. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

34. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan, at ang pag-aaral na ito ay nagbibigay ng karagdagang kulay sa kanyang karanasan.

35. Pakukuluan ko nang apat na oras. Ikaw?

36. Tumayo ako para tingnan yung itsura ko ngayon.

37. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

38. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

39. I have finished my homework.

40. She's always creating drama over nothing - it's just a storm in a teacup.

41. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

42. Nasa harap ako ng istasyon ng tren.

43. The surface of the football field can vary, but it is typically made of grass or artificial turf.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

46. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

47. Wala naman sa palagay ko.

48. Nabahala si Aling Rosa.

49. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

50.

Similar Words

processes

Recent Searches

generatedprocessmessagecontinuepackagingmediumsaypalanglovechangekailangangpapasoknapakahangagenerationerbefolkningen,manggagalingtaon-taonslavestillkirbyumuwisanmalayongpublishedminutowowyepmagawangnararapatneropagkakatuwaannamumulaklakkatuwaanimporutak-biyahinimas-himasmahihiraprevolutioneretnagtataasinirapaneconomygagawineskwelahannaglalaronagpaiyaknaglipanangisinulatnagmamaktolmanlalakbaypinag-usapannagliliyabtumiramakasalanangmaisusuotpahiramnakatindiglumuwashalikatilgangpakiramdammaabutancardiganeksenapatakbohouseholdibinaonmamalasnanunuksotindapagsubokmagsugalninanaismantikamagisiplever,cosechar,natanongkastilangbayanisandwichpagmasdansuriintamarawmaskinermanakbogaanoberetinapakaniyouniversitiesnatitirangpaglayasmaluwagtawanan1787kumapittatlokamalayanmagdilimmaramotpresencejolibeegreatly1960snakatinginnasuklamsayawanhinintaypaggawatsupersinesapotbrasoarkiladesarrollarpublicityhdtvmalayangnagdarasalsetyembretarcilaginaganoonautomationilocospopcornnaroonestarbuslofar-reachingtransmitspunsokasingtigastresparangpinalutolargerrelonakakaalamcommunitymagpuntanagdaramdamahitlayasstrategypedecharminglegislativedaysbarriersgenerationsfreelancervampiresalignsgandapedengguroipapahingapapuntabroadsagingeducationalinalokpollutionalerangetablejunjuninfinityeitherinteligentesuponsecarsebudoknagpasyaestudyanteunakapaligiranprimerasenterdagatvisualisagagaloobgovernmentpagimbayestablisimyentomay-arimensaheseriouspayatamingdayhapag-kainannaglalakadmaingaywastelalakenakakalayotiyak