Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "process"

1. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

2. Congress are elected every two years in a process known as a midterm election

3. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

4. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

5. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

6. Frustration can be a normal part of the learning process and can lead to personal growth and development.

7. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

8. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

9. Investing refers to the process of allocating resources with the expectation of generating a profit.

10. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

11. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

12. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

13. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

14. The President is elected every four years through a process known as the presidential election

15. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

16. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

17. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

18. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

2. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

3. Pwede ba kitang tulungan?

4. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

5. Nagpa-photocopy ng report si Kiko.

6. Ano bang nangyari? tanong ni Lana.

7. Magkasingganda ang rosas at ang orkidyas.

8. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

9. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

10. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

11. Ang poot ang nagpapagana sa aking determinasyon na magtagumpay at patunayan ang aking sarili.

12. Ang laki nang mga gusali sa maynila!

13.

14. Comer saludable es esencial para mantener una buena salud.

15. Maganda ang kulay ng mga puno sa panahon

16. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

17. Sino ang bumisita kay Maria?

18. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

19. Bumili kami ng isang piling ng saging.

20. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

21. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

22. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

23. The objective of football is to score goals by kicking the ball into the opposing team's net.

24. Mayroon pa ho sana akong gustong itanong.

25. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

26. The disagreement between them turned out to be a storm in a teacup.

27. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

28. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

29. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

30. Athena.. malapit na tayo.. konting tiis na lang..

31. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

32. He admires the honesty and integrity of his colleagues.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Ang bagal ng internet sa India.

35. Emphasis is often used to highlight important information or ideas.

36. Ilang kuwarto ho ang gusto niyo?

37. Matapos ang isang mahirap na araw, nagpalabas ako ng malalim na himutok para maibsan ang aking pagod.

38. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

39. At sana nama'y makikinig ka.

40. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

41. Ang takip-silim ay isang magandang panahon upang magpahinga at magrelax mula sa mga pagod ng araw.

42. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

43. Naaalala mo pa ba noong tayo pang dalawa.

44. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

45. Las escuelas también ofrecen programas de educación para adultos.

46. Namamangha at nananaghili sa ganda ng magkakapatid ang mga dalaga sa kanilang nayon.

47. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

48. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

49. Walang telebisyon sa kuwarto ni Fiona.

50. Nagluto ako ng paborito kong pagkain kaya masayang-masaya ako ngayon.

Similar Words

processes

Recent Searches

junjunrangemethodsprocesspasinghaledit:requireamazonabanganbooksnakatitiyakerhvervslivetkatawangmarurumiestasyonpaglakimagtatakamaawaingliligawanprogramamabutibyejuanworkingprogrammingmaibigankaugnayanpag-uugalieditfulfillmentlalapitpagkalungkotelectroniciniwanimikomeletteipagpalitsomethingfuncioneskannunomaglalakadgirlkumaripasrosematulunginpulisninanaisyumabangpaghangalumamangtumahanhulumagkasamakinasisindakanhanginhubad-baropobrengnakakapamasyalpangungutyamakakatakasmusicianpagkamanghakahaponpaumanhineskuwelaluluwasgulattatlumpungactingpagkasabitumatanglawphilanthropykasiyahanmagpapagupitcountrypagtangisatensyongcancerpumilitaxinakilalagawinpakinabangannaglarokamandagtumambadbinitiwan1970snakaakyatipinauutangginawangnavigationmahabolseryosongmusicalpinisilunconstitutionalumiwassakenincitamenterlumiitkabighalaranganmaonglangkaydespuesguidancenatulakindependentlycalidadbinigyanmahiyaanaynamakombinationnenapublicitypinalayasnagisingkuwebatinitindapinanoodnapadaanagostomatalimengkantadamaaksidenteagilaendvidereahhhhcommunityteleviewingtakesnagdaramdamfuefeltsparesaidbulongjennybasketballfrescoparkematulispasensyanuhtoyaksidentefredreadingenergiplatformsdigitalparatingeksaytedtrueklasrumpunsoitimpriestnagtaasmangingisdamalayangnapatinginnaiinisyongmaslaruinsurgerypassworddinggincountriesmalagodyanmurangdesdeparacountlesspublishedprogramming,electshiftmagpa-ospitalngunitnakadaparosaeskwelahanpaglalaitinirapanisasabaddesisyonannag-emailtumakboitinaasnatanongmanilbihansuriineroplano