Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "national"

1. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

2. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

3. Representatives can be found at various levels of government, such as local, regional, national, or international.

4. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

5. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

6. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

7. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

8. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

9. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

10. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

11. The United States has a system of federalism, where power is divided between the national government and the individual states

12. The United States is a federal republic, meaning that power is divided between the national government and the individual states

13. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

14. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

15. TikTok has been banned in some countries over concerns about national security and censorship.

Random Sentences

1. Ang aking anak ay madalas manood ng Baby shark sa youtube.

2. Napangiti siyang muli.

3. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

4. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

5. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

6. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

7. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

8. Sa tradisyon ng kanilang kultura, isang malaking kaganapan ang pagpapakilala ng pamilya ng lalaki sa pamilya ng babae sa pamamamanhikan.

9. "Dogs are not our whole life, but they make our lives whole."

10. The dog barks at the mailman.

11. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

12. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

13. Traveling to a conflict zone is considered very risky.

14. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

15. La pobreza afecta no solo a las personas, sino también a las comunidades enteras.

16. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

17. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

18. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

19. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

20. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

21. Tweets are limited to 280 characters, promoting concise and direct communication.

22. Sa bawat bagong taon, may ritwal silang ginagawa upang magdala ng suwerte at kasaganaan sa buong pamilya.

23. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

24. Magandang araw, sana pwede ba kita makilala?

25. Malapit na naman ang eleksyon.

26. Pumasok ako sa isang malaking kuwarto na halos hindi ko makita dahil sa sobrang pagdidilim ng mga ilaw.

27. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

28. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

29. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

30. The wedding ceremony is often followed by a honeymoon.

31. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

32. Ang may-akda ay nagsusulat ng libro upang ibahagi ang kaniyang kaalaman at karanasan.

33. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

34. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

35. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

36. Nagugutom na din ang mga tao sa lugar nila at ang dating mapagbigay na mga tao ay nag-aagawan na.

37. Lumiwanag ang aking puso sa simpleng "salamat."

38. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

39. La falta de recursos económicos hace que sea difícil para las personas pobres salir adelante.

40. Kanino mo pinaluto ang adobo?

41. Les personnes endettées peuvent se retrouver dans une situation financière difficile.

42. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

43. Napa wow na lang ako ng makita ko ang kanyang suot na bestida.

44. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

45. Format your book: Once your book is finalized, it's time to format it for publication

46. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

47. Sa gitna ng katahimikan ng gabi, narinig ang panaghoy ng isang inang nawalan ng anak.

48. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

49. Masaya naman talaga sa lugar nila.

50. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

Recent Searches

makapangyarihangnationalmusicalespinag-aralanfactoreslagunanahigabahagyaphilippinepaga-alalapatutunguhanpsssmelvinconsuelotalagakumatoknabighanifueldedication,finishedskyldes,images1940hinintaynakahugdrinksnatutulogpagbabayadnagsamanagbantaynahulogsagutinkangitansamfunddefinitivohouseholdpaapopularizetabing-dagatitutolpaanokabuhayansiguradonatuloggottamarawangkaninventadopupuntapatunayansaringberegningermoodpagputidividedtermarmedtawananatensyonsasakaypuedepangitthreemanilbihanpaskongnatakotcreationwalletkasiiginitgitpangulomahirapgraduallyoverviewrepresentativemulighedkasinglalongpisomahiwagangemphasissumusunodnakabaonfysik,sundalosorebinawiipagbiliiniirogfullpapuntanghikingokaytwitchfionakaramihanpinabulaanheartbeatdisciplinmapuputibiocombustiblescongratsayonbakuranganitotuwang-tuwadespuesderrepresentedoverallna-curiousespadaisaactypesnagdiretsopoorerkondisyonninanaischoigatolnakilalaviolencedemocraticsoonbeintekalaunanibigtugonyonnilinisplasamaistorboeeeehhhhboyetinfluentiallasingerosapatospulispakilagaytalagangkapatawaranmalapalasyokarangalanmaliksiangelaawardculturalmemorialhinilapinag-usapanbayanimagbibiyahesenadorannabingofilipinaosakaeskuwelahaninjurypakaininsisentadumaanbasketballconsideredkidkiranlaronglumbayde-latabinibilangseriouspakibigyanlastwidenahulaanpagkaawatinderainiindanakarinigtigasofferbecomingrailwaysredesconsumenakatunghayonlyhandaannakainomsmokingmayroonpwedengsamanevermesanggaplarokambingmaghahatidritwalvasques