Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "national"

1. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

2. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

3. Representatives can be found at various levels of government, such as local, regional, national, or international.

4. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

5. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

6. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

7. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

8. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

9. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

10. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

11. The United States has a system of federalism, where power is divided between the national government and the individual states

12. The United States is a federal republic, meaning that power is divided between the national government and the individual states

13. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

14. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

15. TikTok has been banned in some countries over concerns about national security and censorship.

Random Sentences

1. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

2. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

3. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

4. Nasa Diyos ang awa, nasa tao ang gawa.

5. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

6. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

7. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

8. Ako na ang bahala dito. aniya at akmang tatayo na.

9. Ikaw pala, Katie! Magandang hapon naman.

10. Kailangan na nya makuha ang resulta ng medical exam bukas.

11. Sino ang kasama niya sa trabaho?

12. Aller Anfang ist schwer.

13. Sino ang maghahatid sa akin sa pier?

14. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

15. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

16. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

17. Ang malakas na pagsabog ng bulkan ay binulabog ang buong komunidad.

18. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

19. Pumunta kami sa Cebu noong Sabado.

20. Umalis sa sakayan ang mga pasahero nang limahan.

21. Ada berbagai macam jenis doa, seperti doa harian, doa syukur, doa permohonan, dan lain sebagainya.

22. Work can also have a social aspect, providing opportunities to meet new people and make connections.

23. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

24. Many dogs enjoy going on walks and exploring new environments.

25. At minamadali kong himayin itong bulak.

26. Les travailleurs doivent se conformer aux normes de sécurité sur le lieu de travail.

27. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

28. Saan kami kumakain ng mami at siopao?

29. Aray! Bakit mo ako sinapak! Potaena mo naman!

30. Napapaisip ako kung ano pa ang mga magagandang paraan upang mapaligaya ang aking nililigawan.

31. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. No puedo controlar el futuro, así que "que sera, sera."

34. Patuloy pa rin ang paghalik ng butiki sa lupa tuwing dapit-hapon.

35. Ang pagpapakain ng mais sa tamang oras at pag-alaga sa mga halaman ay magbibigay sa iyo ng masaganang ani

36. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

37. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

38. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

39. Sumalakay nga ang mga tulisan.

40. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

41. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

42. Layuan mo ang aking anak!

43. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

44. Ngayon ka lang makakakaen dito?

45. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

46. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

47. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

48. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

49. Nasa harap ng bangko ang bus stop.

50. Nagbabakasyon ako sa beach kasama ang pamilya kaya masayang-masaya ako ngayon.

Recent Searches

nationalkisapmatahagdananpundidominatamisculturesnaabotpapalapitsarisaringnapawitamarawpaalamafternoonkailanmantusongunangexigenteconclusion,iikotpaglayasrewardingsteamshipstiemposeleksyondalawinbihasapesoskanayangmawalasongsvegasdatungpaggawagrowth1960skasuutanarabiasumasaliweksportenkinanetflixvivawifisocialeindividualsmissionyeymaisipmagalangtrescomunicanmalikotsundaesaramarmaingbilibitutolbingosubalitburgerpakelamwalistakesmestbio-gas-developingjose1940successcebuknowsmuchassamurhythmtryghedagaitakprovetopic,buladahonfistsleeplayspasokuriwatchtableulobehaviorinteligentesgapinaapithreeipinalitfirstibonmaawainghulimatabroadcastsmagkasintahankinapanayamnapapatungokabundukankulturtanghalipinangyarihanaguadinaananmaalikabokdidingwindowformsperangcomputererrors,nanggagamotsinundankulaylikehelpedilannahuhumalingalagangnangangahoykikitatinatawagkinagalitannakapagreklamomakapangyarihanglumalangoypoliticalnakakapamasyalhayaanpaghaharutankahulugannakatindigstrategiessharmainepinasalamatanpambahayimpormagpapagupith-hoynangangaraliintayinisasabadpagsalakaynasasakupanpagtataposlumiwanagmahawaannapakagagandapagkuwaalikabukinpalibhasapinigilandesisyonanmakabawiasignaturabalediktoryanintensidadnagtataeseguridadpagkainisnaglokomagbibigaynaliligokesosenadormakapagempakebowltaga-ochandotelebisyongumigisingkilongmarasiganpagtatakapinabulaanadvancementminervienobodyhinatidnaawafavorpapuntangbalikatindustriyangititulongeconomicandreadakilangaustraliajulietsasapakinvitaminnapadpadmaaksidentepangalanan