Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "national"

1. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

2. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

3. Representatives can be found at various levels of government, such as local, regional, national, or international.

4. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

5. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

6. The Constitution of the United States, adopted in 1787, outlines the structure and powers of the national government

7. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

8. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

9. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

10. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

11. The United States has a system of federalism, where power is divided between the national government and the individual states

12. The United States is a federal republic, meaning that power is divided between the national government and the individual states

13. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

14. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

15. TikTok has been banned in some countries over concerns about national security and censorship.

Random Sentences

1. Kaya't pinabayaan na lang niya ang kanyang anak.

2. Ang kuripot ng kanyang nanay.

3. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

4. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

5. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

6. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

7. Ang edukasyon lamang ang maipapamana ko sayo.

8. Ano ang gagawin mo sa Linggo?

9. Hindi pa nga ako nagtatanghalian eh.

10. The United States is a federal republic consisting of 50 states, a federal district, and five major self-governing territories.

11. Mabibingi ka sa ingay ng kulog.

12. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

13. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

14. Las escuelas pueden ser públicas o privadas, coeducacionales o exclusivas para hombres o mujeres.

15. Sa pagdating ng suporta ng aking mga kaibigan, ang aking pag-aalala ay napawi.

16. Nakakalasing pala ang wine pag napasobra.

17. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

18. Napatingin yung 7 na babaeng classmate namin na naguusap.

19. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

20. "Dogs come into our lives to teach us about love and loyalty."

21. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

22. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

23. Jeg har fået meget værdifuld erfaring gennem min karriere.

24. Mangiyak-ngiyak siya.

25. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

26. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

27. Påsken er også en tid, hvor mange familier samles og fejrer sammen.

28. Kumakanta kasama ang Filipino Choir.

29. Ang pagtulog ay mahalaga para sa kalusugan at kagalingan ng isang tao.

30. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

31. They organized a marathon, with all proceeds going to charitable causes.

32. "Ang oras ay ginto" ay isang bukambibig na nagpapahiwatig ng halaga ng paggamit ng oras nang maayos at wasto.

33. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

34. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

35. A father is a male parent in a family.

36. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

37. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

38. Nandoon lamang pala si Maria sa library.

39. The government is working on measures to reduce traffic pollution in urban areas.

40. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

41. The dancers are not rehearsing for their performance tonight.

42. Ibinabaon ng magnanakaw ang kanyang ninakaw na yaman sa ilalim ng puno.

43. Anong panghimagas ang gusto nila?

44. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

45. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

46. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

47. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

48. Keep in mind that making money online takes time, effort, and patience

49. Ano ang mga ginawa niya sa isla?

50. Sa mga kasal, kadalasan ay mayroong programa ng sayawan upang mas masaya ang pagdiriwang.

Recent Searches

gumigisingtog,kampeonhinanakitngitinationalnaglutouniversitybutterflymassachusettsdesign,basketballnaawakastilafavornuevosiikotunconstitutionalpagmasdanpakibigyannahulaankunwakaysakutodpaldabayangnatitiraipagmalaakiperwisyotsinelasmatalimpangalananaga-agamag-iikasiyamcoinbasepaghabadasalpangilpinagkasundoincidenceherramientawidelymulighederamericanfriendbilanginartebestidabungasouthculpritpopularangkanbilitupelorevolutionizedmalakidibaginaganoonbumigaysumasakitarawilocosproductionneed,neabukodgabingresignationzoomalambingmartesbasahinlalakasingtigassisipainpinapalogamessuccessimportantlegendsmaitimredeswaliscafeteriarailwaysmabilisterminomulighedscientificsamfundjokeinantokgalitsakahomeworkunoactingadventsumapitpollutioninalalayanmagpa-paskotogethercommunicationssumaladedication,outpostumiinithighestcomunicarsesequeartificialyontiyaappstatingreallygeneratelayuninmapapaapatnapuworkdaypagka-maktolbigkisabangannagsunuranmiragradcontentdekorasyonvegasbisikletatakeprogramming,namuhaypigilanmansanasnasanchoibringingfollowingmesanglumilingonvaccinesdumarayopinapakingganbackpackmisyunerongcommercetomorrowsineatinnaghihikabconvertidaskagandahanhateprotestaitinalagangmakikipag-duetonagtatakbomakapaibabawcultivonagtitindabaku-bakongmanggagalingmagagandangmensajesnakapapasongkumitanagtatampopulang-pulakasangkapanmagkaibangpaglisannakatapattumutubodoble-karagirlinakalangnasisiyahansasagutinkumaliwatagtuyotnapakahabamagdoorbellmensaheinabutanmagkasamapinag-aralanpakikipagbabaghitanakakarinigbusinessesyumabongtemperaturamagsungitpakinabangansakupinmaintindihan